Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4645.t1
Gene name
Locationscaffold_10:51268..54983
Strand-
Gene length (bp)3715
Transcript length (bp)3663
Coding sequence length (bp)3663
Protein length (aa) 1221

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02194 PXA PXA domain 1.1E-50 101 281
PF08628 Nexin_C Sorting nexin C terminal 1.2E-24 1089 1194
PF00787 PX PX domain 5.2E-21 864 973
PF00615 RGS Regulator of G protein signaling domain 1.4E-09 415 549

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0008289 lipid binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0005543 phospholipid binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 28 18
2 33 55 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4645.t1
MALSRRDLVLAGVGVFIAWGLVVRWLPILRYLGYALTLGVVLASVGLLGIVTFTIRHQNDRVNLKNVSVAFIKPN
QWRKEVLNVRRSTRYRPRPLYPQSFVVSEGIDELLSFITRDFVSSWYKSISPNPIFANEVDRTIRVALENLRDRL
VAEDMVSLIVSRIFPIVTSHLREFDIAERSVRGRNLSRNVTESGELDLAIANKYREGRLHPAVATSASDQKTVQQ
EYLRKLAVGLLPQLFPQSVLNSRIVSVLIREIISCAVLIPIVTSLSDPDTWNQLMEAYGRTALQDRKTVRKLRAA
LDQHASPAPRSKRGQPFPRLSPADSERAFERFVRAIRKCNNLSDARRFRALVSSQLKQESVVEGQDQVYLKRLET
GKRVLDQKVAKLARPGEDSHVPPALDIRPEAPSRTHESSLIDVMHSASGLSYFMEFMDRQKLMSLVQFWVVVDGL
RNPLEDDFGDEPMPTLLAWKPADRNDLALISETYLSKPELNVSEESRRAVKAFLSAGKRATPEQYRKARMVVLTT
QSAILERLQDTYYPKFKGSDLYWKYIASDEASAAQAPVRQSSPIAVTFETPERRPLPPLLSRTSSQPGLRPSKDL
RRAAVSSGDVRGMGKLFDDDDSLRRSIDSERSAYLFDDDYDTDNLATSTHSLGKDSQNGENDGQSQSQVLETMEA
ALNDIITNEPKNARIEDLKGDAAGLFGSDRPVPSSRSLSETPSVDNRNERTKKSIASLGLVDHASRLGVFDDDLF
PDQQKFIEDEYEEPDGVDEKDPADEVHEAAPGDLGLTEAIEALSVDIDKLAAQDSVVQALTRKAELTNNTAELRI
LRKSKASIQREMHRKEMQRQQYILQESDNSLFGRSTVSLKSTVVGKEEDDGREFAMYVVEVKRNAGEQMPAASWV
VARRYSEFHDLHQKLRQRYPSVRNLEFPRRRVVMKLQKEFLHKRRLALEAYLQKLLLLPEVCRSRDLRAFLSERA
ILPRKETVRDNEGETRDLVTRIYNSVADGMDDFLGNFGVLDQLSTAGQNLISAATQQAISTIVPESGVATEDVVT
AAEAEAELNAFEDRELEPFIKPICDLFLEAFELNRGNNWLRGRAVVVVLHQLLGGTIERKVREGARGLVQDESLL
KYLALARDTLWPGGVLRKAPPRSAADRFNSRAEATVVLATLIPDLAGNVVGRANAQAAARRIFATLNNQHLNTHL
VFTILDEIVLVLFGSSGRSR*
Coding >Pro_DTO377G3_2|g4645.t1
ATGGCCCTTAGTCGCCGCGACTTAGTTCTGGCGGGTGTCGGCGTATTCATCGCCTGGGGTCTTGTGGTTCGCTGG
CTGCCGATCCTCCGGTATCTAGGATATGCCTTGACACTGGGCGTCGTCCTAGCTTCTGTGGGTCTTTTAGGAATT
GTCACATTCACAATCCGGCATCAGAATGACAGAGTCAACCTCAAGAACGTTTCGGTGGCTTTCATAAAACCTAAC
CAATGGCGAAAGGAAGTGCTGAATGTCCGCCGGAGCACGCGATACCGTCCCCGGCCACTCTATCCCCAGTCCTTT
GTCGTGTCGGAAGGAATCGACGAACTTCTGTCTTTTATTACTCGAGACTTTGTTTCATCGTGGTACAAAAGTATC
AGTCCGAACCCTATATTTGCCAATGAAGTTGATCGAACGATTCGCGTCGCTCTTGAAAACCTCCGGGATAGGTTG
GTTGCGGAGGATATGGTGTCGCTGATCGTATCGCGTATCTTTCCTATCGTGACATCGCACCTCAGAGAATTTGAC
ATTGCCGAGCGTTCTGTTCGGGGACGCAATCTCAGTCGAAATGTGACCGAGTCTGGAGAGCTTGATCTGGCCATT
GCGAACAAATACCGGGAAGGTCGCTTACATCCTGCCGTTGCGACCTCGGCGTCCGATCAAAAGACTGTTCAACAG
GAGTACCTGCGCAAGCTAGCGGTTGGCCTTCTACCACAGCTATTCCCCCAAAGCGTGCTAAACAGTCGAATTGTG
TCGGTTCTGATTCGCGAAATCATCTCATGCGCTGTGCTTATTCCGATAGTCACTTCATTGTCGGACCCAGACACA
TGGAACCAATTAATGGAAGCATATGGCCGTACAGCTCTGCAGGATCGGAAGACTGTACGCAAACTGCGCGCCGCT
CTAGACCAGCATGCGTCACCTGCACCTAGGTCTAAGCGTGGGCAACCATTCCCGCGACTGTCACCAGCCGATTCA
GAGCGAGCCTTTGAGCGCTTTGTGAGGGCAATTAGGAAATGTAATAACCTCTCCGATGCCCGTCGTTTTCGCGCC
CTCGTTTCCAGTCAATTGAAGCAGGAGAGTGTGGTCGAGGGCCAGGATCAGGTCTATCTGAAGCGTCTAGAAACA
GGAAAACGTGTTCTTGATCAGAAAGTGGCGAAACTTGCGAGACCTGGCGAGGACTCCCATGTACCTCCAGCACTA
GACATTCGACCTGAGGCTCCATCTAGAACACATGAATCGTCACTGATTGATGTGATGCACAGTGCATCTGGGCTT
TCTTATTTCATGGAGTTTATGGACCGCCAAAAGCTGATGTCGCTTGTTCAATTCTGGGTTGTTGTAGATGGATTG
CGCAACCCACTTGAAGATGACTTTGGAGATGAGCCAATGCCTACTTTATTAGCATGGAAGCCAGCAGACAGAAAC
GACCTAGCTCTCATCAGCGAAACCTACCTTTCAAAGCCGGAACTGAATGTCTCTGAAGAGTCTCGCCGAGCAGTC
AAGGCATTCCTGAGTGCAGGAAAGCGCGCCACCCCGGAACAATACCGAAAAGCGCGAATGGTGGTTTTGACAACC
CAGTCTGCCATTCTAGAGCGTCTCCAGGATACTTATTACCCGAAGTTCAAGGGGTCTGATCTGTACTGGAAGTAT
ATTGCGTCCGACGAAGCATCCGCTGCCCAGGCGCCAGTTCGGCAATCCTCCCCCATAGCAGTCACTTTTGAAACT
CCCGAGAGGCGACCTCTGCCCCCTTTGTTGTCGAGAACCAGTTCCCAGCCGGGATTGAGACCATCCAAAGACCTT
CGACGAGCCGCTGTCTCGTCTGGTGATGTGCGGGGCATGGGGAAATTATTTGATGATGATGATTCATTACGGCGA
TCAATAGATTCAGAACGATCTGCTTATCTTTTTGATGACGACTATGACACTGACAATCTGGCCACATCCACCCAT
AGTTTGGGCAAGGATTCGCAGAATGGCGAGAATGATGGCCAGAGCCAAAGCCAAGTTCTCGAGACGATGGAGGCA
GCACTCAATGATATCATTACCAACGAGCCGAAAAATGCGAGAATCGAAGACCTCAAAGGAGATGCTGCTGGTCTA
TTCGGGTCGGACCGTCCTGTTCCTTCGTCGCGCAGCTTGTCTGAAACTCCTTCGGTTGACAACCGGAATGAAAGA
ACCAAGAAAAGCATCGCATCGCTTGGTTTGGTGGATCATGCGTCACGACTTGGGGTCTTTGATGACGACTTATTT
CCAGATCAACAGAAATTTATCGAAGACGAATACGAAGAACCAGACGGCGTGGATGAAAAGGACCCAGCAGATGAA
GTGCACGAAGCTGCACCAGGTGACTTGGGTCTAACGGAGGCGATTGAGGCACTCTCAGTAGATATCGACAAACTT
GCAGCCCAGGACTCCGTAGTCCAAGCATTGACACGCAAAGCAGAACTGACAAACAACACCGCGGAACTGAGAATC
CTGCGCAAGTCCAAGGCCAGCATCCAGCGTGAAATGCACCGCAAGGAAATGCAGCGGCAACAGTACATTCTCCAG
GAAAGCGATAACAGCTTATTTGGGCGATCGACCGTTAGCCTCAAGTCTACCGTCGTAGGCAAAGAGGAGGACGAT
GGCCGTGAATTTGCAATGTACGTGGTGGAGGTCAAAAGAAATGCCGGCGAGCAAATGCCCGCCGCATCGTGGGTC
GTTGCACGACGATACAGCGAGTTCCATGATCTGCATCAAAAGCTACGCCAACGCTACCCCTCCGTCCGGAACTTG
GAATTTCCCCGGCGACGAGTCGTTATGAAGCTACAGAAAGAGTTCCTTCACAAACGGCGACTCGCTCTCGAAGCC
TATCTGCAGAAACTCCTCCTTCTGCCAGAGGTCTGCCGCAGCCGCGATCTACGTGCATTCCTCTCTGAACGTGCC
ATCCTACCCCGTAAGGAAACCGTTCGCGACAACGAGGGTGAAACAAGAGACCTTGTCACACGCATCTACAACTCC
GTCGCAGACGGCATGGATGACTTCCTCGGCAACTTTGGCGTCCTAGACCAACTATCTACCGCAGGCCAAAACCTC
ATATCTGCCGCCACCCAGCAAGCCATCAGCACGATAGTCCCAGAATCCGGCGTCGCAACCGAAGACGTCGTCACA
GCAGCCGAAGCCGAAGCGGAACTAAACGCCTTCGAAGACCGCGAGCTCGAGCCATTCATCAAGCCCATCTGTGAT
CTCTTCCTCGAAGCCTTCGAGCTGAACCGCGGCAACAACTGGCTGCGCGGCCGTGCAGTCGTCGTTGTTCTGCAC
CAGCTCCTCGGCGGGACAATAGAGCGCAAGGTCCGCGAGGGAGCACGCGGCCTGGTACAGGATGAGTCCCTTCTC
AAGTACCTTGCTCTCGCTCGCGATACGCTCTGGCCCGGCGGCGTGCTTCGCAAAGCCCCTCCGCGTTCAGCCGCA
GATCGTTTCAATAGTCGTGCCGAGGCTACTGTGGTCTTGGCTACCCTCATTCCAGATTTAGCGGGTAATGTGGTC
GGCAGAGCTAATGCACAGGCTGCTGCCCGTCGCATCTTTGCTACGCTCAATAACCAACATCTTAATACCCATCTT
GTTTTTACGATTCTTGACGAGATTGTTTTGGTTCTCTTTGGGAGTTCGGGCCGTTCTCGATGA
Transcript >Pro_DTO377G3_2|g4645.t1
ATGGCCCTTAGTCGCCGCGACTTAGTTCTGGCGGGTGTCGGCGTATTCATCGCCTGGGGTCTTGTGGTTCGCTGG
CTGCCGATCCTCCGGTATCTAGGATATGCCTTGACACTGGGCGTCGTCCTAGCTTCTGTGGGTCTTTTAGGAATT
GTCACATTCACAATCCGGCATCAGAATGACAGAGTCAACCTCAAGAACGTTTCGGTGGCTTTCATAAAACCTAAC
CAATGGCGAAAGGAAGTGCTGAATGTCCGCCGGAGCACGCGATACCGTCCCCGGCCACTCTATCCCCAGTCCTTT
GTCGTGTCGGAAGGAATCGACGAACTTCTGTCTTTTATTACTCGAGACTTTGTTTCATCGTGGTACAAAAGTATC
AGTCCGAACCCTATATTTGCCAATGAAGTTGATCGAACGATTCGCGTCGCTCTTGAAAACCTCCGGGATAGGTTG
GTTGCGGAGGATATGGTGTCGCTGATCGTATCGCGTATCTTTCCTATCGTGACATCGCACCTCAGAGAATTTGAC
ATTGCCGAGCGTTCTGTTCGGGGACGCAATCTCAGTCGAAATGTGACCGAGTCTGGAGAGCTTGATCTGGCCATT
GCGAACAAATACCGGGAAGGTCGCTTACATCCTGCCGTTGCGACCTCGGCGTCCGATCAAAAGACTGTTCAACAG
GAGTACCTGCGCAAGCTAGCGGTTGGCCTTCTACCACAGCTATTCCCCCAAAGCGTGCTAAACAGTCGAATTGTG
TCGGTTCTGATTCGCGAAATCATCTCATGCGCTGTGCTTATTCCGATAGTCACTTCATTGTCGGACCCAGACACA
TGGAACCAATTAATGGAAGCATATGGCCGTACAGCTCTGCAGGATCGGAAGACTGTACGCAAACTGCGCGCCGCT
CTAGACCAGCATGCGTCACCTGCACCTAGGTCTAAGCGTGGGCAACCATTCCCGCGACTGTCACCAGCCGATTCA
GAGCGAGCCTTTGAGCGCTTTGTGAGGGCAATTAGGAAATGTAATAACCTCTCCGATGCCCGTCGTTTTCGCGCC
CTCGTTTCCAGTCAATTGAAGCAGGAGAGTGTGGTCGAGGGCCAGGATCAGGTCTATCTGAAGCGTCTAGAAACA
GGAAAACGTGTTCTTGATCAGAAAGTGGCGAAACTTGCGAGACCTGGCGAGGACTCCCATGTACCTCCAGCACTA
GACATTCGACCTGAGGCTCCATCTAGAACACATGAATCGTCACTGATTGATGTGATGCACAGTGCATCTGGGCTT
TCTTATTTCATGGAGTTTATGGACCGCCAAAAGCTGATGTCGCTTGTTCAATTCTGGGTTGTTGTAGATGGATTG
CGCAACCCACTTGAAGATGACTTTGGAGATGAGCCAATGCCTACTTTATTAGCATGGAAGCCAGCAGACAGAAAC
GACCTAGCTCTCATCAGCGAAACCTACCTTTCAAAGCCGGAACTGAATGTCTCTGAAGAGTCTCGCCGAGCAGTC
AAGGCATTCCTGAGTGCAGGAAAGCGCGCCACCCCGGAACAATACCGAAAAGCGCGAATGGTGGTTTTGACAACC
CAGTCTGCCATTCTAGAGCGTCTCCAGGATACTTATTACCCGAAGTTCAAGGGGTCTGATCTGTACTGGAAGTAT
ATTGCGTCCGACGAAGCATCCGCTGCCCAGGCGCCAGTTCGGCAATCCTCCCCCATAGCAGTCACTTTTGAAACT
CCCGAGAGGCGACCTCTGCCCCCTTTGTTGTCGAGAACCAGTTCCCAGCCGGGATTGAGACCATCCAAAGACCTT
CGACGAGCCGCTGTCTCGTCTGGTGATGTGCGGGGCATGGGGAAATTATTTGATGATGATGATTCATTACGGCGA
TCAATAGATTCAGAACGATCTGCTTATCTTTTTGATGACGACTATGACACTGACAATCTGGCCACATCCACCCAT
AGTTTGGGCAAGGATTCGCAGAATGGCGAGAATGATGGCCAGAGCCAAAGCCAAGTTCTCGAGACGATGGAGGCA
GCACTCAATGATATCATTACCAACGAGCCGAAAAATGCGAGAATCGAAGACCTCAAAGGAGATGCTGCTGGTCTA
TTCGGGTCGGACCGTCCTGTTCCTTCGTCGCGCAGCTTGTCTGAAACTCCTTCGGTTGACAACCGGAATGAAAGA
ACCAAGAAAAGCATCGCATCGCTTGGTTTGGTGGATCATGCGTCACGACTTGGGGTCTTTGATGACGACTTATTT
CCAGATCAACAGAAATTTATCGAAGACGAATACGAAGAACCAGACGGCGTGGATGAAAAGGACCCAGCAGATGAA
GTGCACGAAGCTGCACCAGGTGACTTGGGTCTAACGGAGGCGATTGAGGCACTCTCAGTAGATATCGACAAACTT
GCAGCCCAGGACTCCGTAGTCCAAGCATTGACACGCAAAGCAGAACTGACAAACAACACCGCGGAACTGAGAATC
CTGCGCAAGTCCAAGGCCAGCATCCAGCGTGAAATGCACCGCAAGGAAATGCAGCGGCAACAGTACATTCTCCAG
GAAAGCGATAACAGCTTATTTGGGCGATCGACCGTTAGCCTCAAGTCTACCGTCGTAGGCAAAGAGGAGGACGAT
GGCCGTGAATTTGCAATGTACGTGGTGGAGGTCAAAAGAAATGCCGGCGAGCAAATGCCCGCCGCATCGTGGGTC
GTTGCACGACGATACAGCGAGTTCCATGATCTGCATCAAAAGCTACGCCAACGCTACCCCTCCGTCCGGAACTTG
GAATTTCCCCGGCGACGAGTCGTTATGAAGCTACAGAAAGAGTTCCTTCACAAACGGCGACTCGCTCTCGAAGCC
TATCTGCAGAAACTCCTCCTTCTGCCAGAGGTCTGCCGCAGCCGCGATCTACGTGCATTCCTCTCTGAACGTGCC
ATCCTACCCCGTAAGGAAACCGTTCGCGACAACGAGGGTGAAACAAGAGACCTTGTCACACGCATCTACAACTCC
GTCGCAGACGGCATGGATGACTTCCTCGGCAACTTTGGCGTCCTAGACCAACTATCTACCGCAGGCCAAAACCTC
ATATCTGCCGCCACCCAGCAAGCCATCAGCACGATAGTCCCAGAATCCGGCGTCGCAACCGAAGACGTCGTCACA
GCAGCCGAAGCCGAAGCGGAACTAAACGCCTTCGAAGACCGCGAGCTCGAGCCATTCATCAAGCCCATCTGTGAT
CTCTTCCTCGAAGCCTTCGAGCTGAACCGCGGCAACAACTGGCTGCGCGGCCGTGCAGTCGTCGTTGTTCTGCAC
CAGCTCCTCGGCGGGACAATAGAGCGCAAGGTCCGCGAGGGAGCACGCGGCCTGGTACAGGATGAGTCCCTTCTC
AAGTACCTTGCTCTCGCTCGCGATACGCTCTGGCCCGGCGGCGTGCTTCGCAAAGCCCCTCCGCGTTCAGCCGCA
GATCGTTTCAATAGTCGTGCCGAGGCTACTGTGGTCTTGGCTACCCTCATTCCAGATTTAGCGGGTAATGTGGTC
GGCAGAGCTAATGCACAGGCTGCTGCCCGTCGCATCTTTGCTACGCTCAATAACCAACATCTTAATACCCATCTT
GTTTTTACGATTCTTGACGAGATTGTTTTGGTTCTCTTTGGGAGTTCGGGCCGTTCTCGATGA
Gene >Pro_DTO377G3_2|g4645.t1
ATGGCCCTTAGTCGCCGCGACTTAGTTCTGGCGGGTGTCGGCGTATTCATCGCCTGGGGTCTTGTGGTTCGCTGG
CTGCCGATCCTCCGGTATCTAGGATATGCCTTGACACTGGGCGTCGTCCTAGCTTCTGTGGGTCTTTTAGGAATT
GTCACATTCACAATCCGGCATCAGAATGACAGAGTCAACCTCAAGAACGTTTCGGTGGCTTTCATAAAACCTAAC
CAATGGCGAAAGGAAGTGCTGAATGTCCGCCGGAGCACGCGATACCGTCCCCGGCCACTCTATCCCCAGTCCTTT
GTCGTGTCGGAAGGAATCGACGAACTTCTGTCTTTTATTACTCGAGACTTTGTTTCATCGTGGTACAAAAGTATC
AGTCCGAACCCTATATTTGCCAATGAAGTTGATCGAACGATTCGCGTCGCTCTTGAAAACCTCCGGGATAGGTTG
GTTGCGGAGGATATGGTGTCGCTGATCGTATCGCGTATCTTTCCTATCGTGACATCGCACCTCAGAGAATTTGAC
ATTGCCGAGCGTTCTGTTCGGGGACGCAATCTCAGTCGAAATGTGACCGAGTCTGGAGAGCTTGATCTGGCCATT
GCGAACAAATACCGGGAAGGTCGCTTACATCCTGCCGTTGCGACCTCGGCGTCCGATCAAAAGACTGTTCAACAG
GAGTACCTGCGCAAGCTAGCGGTTGGCCTTCTACCACAGCTATTCCCCCAAAGCGTGCTAAACAGTCGAATTGTG
TCGGTTCTGATTCGCGAAATCATCTCATGCGCTGTGCTTATTCCGATAGTCACTTCATTGTCGGACCCAGACACA
TGGAACCAATTAATGGAAGCATATGGCCGTACAGCTCTGCAGGATCGGAAGACTGTACGCAAACTGCGCGCCGCT
CTAGACCAGCATGCGTCACCTGCACCTAGGTCTAAGCGTGGGCAACCATTCCCGCGACTGTCACCAGCCGATTCA
GAGCGAGCCTTTGAGCGCTTTGTGAGGGCAATTAGGAAATGTAATAACCTCTCCGATGCCCGTCGTTTTCGCGCC
CTCGTTTCCAGTCAATTGAAGCAGGAGAGTGTGGTCGAGGGCCAGGATCAGGTCTATCTGAAGCGTCTAGAAACA
GGAAAACGTGTTCTTGATCAGAAAGTGGCGAAACTTGCGAGACCTGGCGAGGACTCCCATGTACCTCCAGCACTA
GACATTCGACCTGAGGCTCCATCTAGAACACATGAATCGTCACTGATTGATGTGATGCACAGTGCATCTGGGCTT
TCTTATTTCATGGAGTTTATGGACCGCCAAAAGCTGATGTCGCTTGTTCAATTCTGGGTTGTTGTAGATGGATTG
CGCAACCCACTTGAAGATGACTTTGGAGATGAGCCAATGCCTACTTTATTAGCATGGAAGCCAGCAGACAGAAAC
GACCTAGCTCTCATCAGCGAAACCTACCTTTCAAAGCCGGAACTGAATGTCTCTGAAGAGTCTCGCCGAGCAGTC
AAGGCATTCCTGAGTGCAGGAAAGCGCGCCACCCCGGAACAATACCGAAAAGCGCGAATGGTGGTTTTGACAACC
CAGTCTGCCATTCTAGAGCGTCTCCAGGATACTTATTACCCGAAGTTCAAGGGGTCTGATCTGTACTGGAAGTAT
ATTGCGTCCGACGAAGCATCCGCTGCCCAGGCGCCAGTTCGGCAATCCTCCCCCATAGCAGTCACTTTTGAAACT
CCCGAGAGGCGACCTCTGCCCCCTTTGTTGTCGAGAACCAGTTCCCAGCCGGGATTGAGACCATCCAAAGACCTT
CGACGAGCCGCTGTCTCGTCTGGTGATGTGCGGGGCATGGGGAAATTATTTGATGATGATGATTCATTACGGCGA
TCAATAGATTCAGAACGATCTGCTTATCTTTTTGATGACGACTATGACACTGACAATCTGGCCACATCCACCCAT
AGTTTGGGCAAGGATTCGCAGAATGGCGAGAATGATGGCCAGAGCCAAAGCCAAGTTCTCGAGACGATGGAGGCA
GCACTCAATGATATCATTACCAACGAGCCGAAAAATGCGAGAATCGAAGACCTCAAAGGAGATGCTGCTGGTCTA
TTCGGGTCGGACCGTCCTGTTCCTTCGTCGCGCAGCTTGTCTGAAACTCCTTCGGTTGACAACCGGAATGAAAGA
ACCAAGAAAAGCATCGCATCGCTTGGTTTGGTGGATCATGCGTCACGACTTGGGGTCTTTGATGACGACTTATTT
CCAGATCAACAGAAATTTATCGAAGACGAATACGAAGAACCAGACGGCGTGGATGAAAAGGACCCAGCAGATGAA
GTGCACGAAGCTGCACCAGGTGACTTGGGTCTAACGGAGGCGATTGAGGCACTCTCAGTAGATATCGACAAACTT
GCAGCCCAGGACTCCGTAGTCCAAGCATTGACACGCAAAGCAGAACTGACAAACAACACCGCGGAACTGAGAATC
CTGCGCAAGTCCAAGGCCAGCATCCAGCGTGAAATGCACCGCAAGGAAATGCAGCGGCAACAGTACATTCTCCAG
GAAAGCGATAACAGCTTATTTGGGCGATCGACCGTTAGCCTCAAGTCTACCGTCGTAGGCAAAGAGGAGGACGAT
GGCCGTGAATTTGCAATGTGTAAGAGACGTTCATACTGCACAGTTTGTTCCAGGCTAACTAGTTATTTCAGACGT
GGTGGAGGTCAAAAGAAATGCCGGCGAGCAAATGCCCGCCGCATCGTGGGTCGTTGCACGACGATACAGCGAGTT
CCATGATCTGCATCAAAAGCTACGCCAACGCTACCCCTCCGTCCGGAACTTGGAATTTCCCCGGCGACGAGTCGT
TATGAAGCTACAGAAAGAGTTCCTTCACAAACGGCGACTCGCTCTCGAAGCCTATCTGCAGAAACTCCTCCTTCT
GCCAGAGGTCTGCCGCAGCCGCGATCTACGTGCATTCCTCTCTGAACGTGCCATCCTACCCCGTAAGGAAACCGT
TCGCGACAACGAGGGTGAAACAAGAGACCTTGTCACACGCATCTACAACTCCGTCGCAGACGGCATGGATGACTT
CCTCGGCAACTTTGGCGTCCTAGACCAACTATCTACCGCAGGCCAAAACCTCATATCTGCCGCCACCCAGCAAGC
CATCAGCACGATAGTCCCAGAATCCGGCGTCGCAACCGAAGACGTCGTCACAGCAGCCGAAGCCGAAGCGGAACT
AAACGCCTTCGAAGACCGCGAGCTCGAGCCATTCATCAAGCCCATCTGTGATCTCTTCCTCGAAGCCTTCGAGCT
GAACCGCGGCAACAACTGGCTGCGCGGCCGTGCAGTCGTCGTTGTTCTGCACCAGCTCCTCGGCGGGACAATAGA
GCGCAAGGTCCGCGAGGGAGCACGCGGCCTGGTACAGGATGAGTCCCTTCTCAAGTACCTTGCTCTCGCTCGCGA
TACGCTCTGGCCCGGCGGCGTGCTTCGCAAAGCCCCTCCGCGTTCAGCCGCAGATCGTTTCAATAGTCGTGCCGA
GGCTACTGTGGTCTTGGCTACCCTCATTCCAGATTTAGCGGGTAATGTGGTCGGCAGAGCTAATGCACAGGCTGC
TGCCCGTCGCATCTTTGCTACGCTCAATAACCAACATCTTAATACCCATCTTGTTTTTACGATTCTTGACGAGAT
TGTTTTGGTTCTCTTTGGGAGTTCGGGCCGTTCTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail