Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4629.t1
Gene name
Locationscaffold_10:18431..18727
Strand+
Gene length (bp)296
Transcript length (bp)240
Coding sequence length (bp)240
Protein length (aa) 80

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00403 HMA Heavy-metal-associated domain 6.6E-17 8 65

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1686.88 1025.02 2348.74
5d_25C Five days - 25 degrees Celsius 1477.95 881.70 2074.19
7d_25C Seven days - 25 degrees Celsius 1541.59 909.46 2173.72
10d_25C Ten days - 25 degrees Celsius 1246.52 742.60 1750.44
7d_15C Seven days - 15 degrees Celsius 1324.85 747.75 1901.94
7d_30C Seven days - 30 degrees Celsius 1072.05 624.06 1520.04

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.632591 no
3d_25C 7d_25C 0.766854 no
3d_25C 7d_15C 0.347400 no
3d_25C 7d_30C 0.037981 yes
3d_25C 10d_25C 0.189796 no
5d_25C 7d_25C 0.903628 no
5d_25C 7d_15C 0.722069 no
5d_25C 7d_30C 0.162701 no
5d_25C 10d_25C 0.517217 no
7d_25C 7d_15C 0.599786 no
7d_25C 7d_30C 0.108580 no
7d_25C 10d_25C 0.396561 no
7d_15C 7d_30C 0.438031 no
7d_15C 10d_25C 0.859240 no
7d_30C 10d_25C 0.590506 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4629.t1
MSDHQYKFNVTMTCGGCSGAVERVLKKLEGVKTFDVSLETQTVNVTTEPTLAYDDVLEKIKKTGKTVNSGEADGE
SKQV*
Coding >Pro_DTO377G3_2|g4629.t1
ATGTCTGATCACCAGTACAAGTTCAATGTGACCATGACCTGCGGCGGATGCTCCGGCGCCGTTGAACGTGTCCTC
AAGAAGCTGGAAGGCGTCAAGACCTTCGATGTTAGCCTCGAGACTCAGACGGTCAATGTCACCACCGAGCCTACT
CTTGCCTACGACGATGTGCTGGAAAAGATTAAGAAGACTGGAAAGACTGTGAACAGTGGAGAGGCGGATGGGGAG
AGCAAGCAGGTTTAG
Transcript >Pro_DTO377G3_2|g4629.t1
ATGTCTGATCACCAGTACAAGTTCAATGTGACCATGACCTGCGGCGGATGCTCCGGCGCCGTTGAACGTGTCCTC
AAGAAGCTGGAAGGCGTCAAGACCTTCGATGTTAGCCTCGAGACTCAGACGGTCAATGTCACCACCGAGCCTACT
CTTGCCTACGACGATGTGCTGGAAAAGATTAAGAAGACTGGAAAGACTGTGAACAGTGGAGAGGCGGATGGGGAG
AGCAAGCAGGTTTAG
Gene >Pro_DTO377G3_2|g4629.t1
ATGTCTGATCACCAGTACAAGTTCAATGTGACCATGACCTGCGGCGGATGCTCCGGCGCCGTTGAACGTGTCCTC
AAGAAGCTGGAAGGTAAGCGACGCGCGGCCTGTTTCATCGTTTTTTGATCCTAACACGTTGGTCTTTAGGCGTCA
AGACCTTCGATGTTAGCCTCGAGACTCAGACGGTCAATGTCACCACCGAGCCTACTCTTGCCTACGACGATGTGC
TGGAAAAGATTAAGAAGACTGGAAAGACTGTGAACAGTGGAGAGGCGGATGGGGAGAGCAAGCAGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail