Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4615.t1
Gene name
Locationscaffold_09:697875..699619
Strand-
Gene length (bp)1744
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00450 Peptidase_S10 Serine carboxypeptidase 6.9E-89 67 508

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004185 serine-type carboxypeptidase activity Yes
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0008236 serine-type peptidase activity No
GO:0004180 carboxypeptidase activity No
GO:0008238 exopeptidase activity No
GO:0019538 protein metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0070008 serine-type exopeptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0017171 serine hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4615.t1
MFGRSISAVLAIALLINGNEARQPTRGPSTRPTQQSEPIDPSNYRFLTNETKSHVVESLPDVNFDLGEMYSGFIP
VRDDASLFYIFQPKIGEPSDDLTIWLNGGPGCSSMQGFLQENGRFTWQPGTYEPVINEYSWVNLTNMLWVDQPVG
VGFSNGTPTATDEEDIAADFVNFFQEFQKTYGIKNFRIFLTGESYAGRYVPFISAAMLDKNDTEYFNLSGALMYD
ACIGQWDYIQAELPSYPFVEQHAELFNFNQSYMGELQATYEECGYKEYFEEYFTYPASGVQPSKQMNYSECDIYN
MIYFEAYNPNPCWSPYKVSQTCPLLWDVLGFPTDLAYQPGPSTYFNRTDVKSALHVPLDIDWELCSIESVFVGVN
PGPEQQYDESANPTEHVLPRLIEATNRVLISNGDWDYLIITNGTLLAIQNMTWNGELGFQTRPTTPITIDTSDLQ
YAPVFTAQDDYGGLDGPQGLMGVQHYERGLMFAETFQAGHRQSQDQGRMSYRHVQWLLGDVERL*
Coding >Pro_DTO377G3_2|g4615.t1
ATGTTCGGTCGATCGATCTCAGCAGTTCTGGCGATCGCACTGCTGATCAATGGCAACGAAGCACGACAGCCGACT
CGAGGCCCTTCTACGCGTCCTACCCAGCAGTCTGAACCAATTGATCCCTCAAACTATCGATTTTTAACTAACGAG
ACTAAATCCCATGTCGTGGAGAGTCTACCGGACGTTAATTTCGATTTGGGAGAGATGTACTCGGGGTTTATCCCT
GTCCGTGACGATGCCTCCTTGTTCTACATATTCCAGCCGAAGATCGGGGAACCAAGCGACGACCTTACAATTTGG
CTGAATGGTGGACCGGGATGTAGTTCAATGCAGGGGTTTCTGCAGGAGAACGGGCGCTTCACCTGGCAACCTGGT
ACCTACGAACCTGTCATCAATGAGTACTCATGGGTTAATTTAACCAATATGTTATGGGTCGACCAACCGGTTGGA
GTTGGGTTCTCAAACGGCACGCCGACTGCAACCGACGAGGAGGACATCGCTGCCGATTTCGTCAACTTTTTCCAA
GAGTTCCAAAAAACATACGGTATTAAGAACTTTCGAATCTTCTTAACTGGTGAGAGTTATGCGGGCCGGTACGTG
CCCTTCATATCCGCCGCCATGCTCGACAAGAATGATACCGAGTACTTCAACCTCAGCGGAGCCCTGATGTATGAT
GCGTGCATCGGCCAGTGGGATTATATCCAGGCCGAACTCCCCTCCTACCCCTTCGTTGAACAACATGCCGAGCTC
TTCAACTTTAACCAATCGTACATGGGGGAGCTGCAAGCTACCTACGAAGAATGCGGTTACAAGGAATACTTCGAG
GAGTATTTCACCTATCCGGCCTCTGGAGTGCAACCCTCCAAACAAATGAACTACTCCGAGTGCGACATCTACAAC
ATGATTTATTTCGAAGCTTATAATCCGAACCCATGTTGGAGTCCTTACAAGGTCAGCCAGACATGTCCACTCTTA
TGGGATGTCCTGGGCTTCCCCACAGACCTTGCCTATCAACCCGGTCCCTCAACCTATTTCAACCGCACGGATGTG
AAGAGCGCTCTGCATGTTCCTCTCGATATCGACTGGGAGCTCTGTAGCATCGAAAGCGTCTTTGTGGGCGTCAAC
CCGGGGCCCGAGCAACAGTACGACGAGTCTGCGAATCCCACAGAGCATGTCCTGCCGCGACTGATCGAGGCGACT
AATCGGGTCTTGATCTCGAATGGAGATTGGGACTATCTGATCATCACGAATGGAACGTTGCTGGCGATCCAGAAC
ATGACCTGGAATGGCGAGCTGGGTTTCCAGACTCGTCCCACCACTCCCATTACTATTGACACGTCCGACTTGCAA
TACGCTCCGGTCTTCACTGCCCAAGACGATTATGGCGGTTTGGATGGTCCACAGGGGTTGATGGGAGTCCAGCAC
TATGAACGTGGTCTGATGTTTGCGGAAACCTTCCAAGCGGGTCATCGACAATCCCAGGATCAAGGCCGAATGTCT
TATCGTCATGTCCAGTGGTTGTTGGGTGATGTTGAGCGTCTTTGA
Transcript >Pro_DTO377G3_2|g4615.t1
ATGTTCGGTCGATCGATCTCAGCAGTTCTGGCGATCGCACTGCTGATCAATGGCAACGAAGCACGACAGCCGACT
CGAGGCCCTTCTACGCGTCCTACCCAGCAGTCTGAACCAATTGATCCCTCAAACTATCGATTTTTAACTAACGAG
ACTAAATCCCATGTCGTGGAGAGTCTACCGGACGTTAATTTCGATTTGGGAGAGATGTACTCGGGGTTTATCCCT
GTCCGTGACGATGCCTCCTTGTTCTACATATTCCAGCCGAAGATCGGGGAACCAAGCGACGACCTTACAATTTGG
CTGAATGGTGGACCGGGATGTAGTTCAATGCAGGGGTTTCTGCAGGAGAACGGGCGCTTCACCTGGCAACCTGGT
ACCTACGAACCTGTCATCAATGAGTACTCATGGGTTAATTTAACCAATATGTTATGGGTCGACCAACCGGTTGGA
GTTGGGTTCTCAAACGGCACGCCGACTGCAACCGACGAGGAGGACATCGCTGCCGATTTCGTCAACTTTTTCCAA
GAGTTCCAAAAAACATACGGTATTAAGAACTTTCGAATCTTCTTAACTGGTGAGAGTTATGCGGGCCGGTACGTG
CCCTTCATATCCGCCGCCATGCTCGACAAGAATGATACCGAGTACTTCAACCTCAGCGGAGCCCTGATGTATGAT
GCGTGCATCGGCCAGTGGGATTATATCCAGGCCGAACTCCCCTCCTACCCCTTCGTTGAACAACATGCCGAGCTC
TTCAACTTTAACCAATCGTACATGGGGGAGCTGCAAGCTACCTACGAAGAATGCGGTTACAAGGAATACTTCGAG
GAGTATTTCACCTATCCGGCCTCTGGAGTGCAACCCTCCAAACAAATGAACTACTCCGAGTGCGACATCTACAAC
ATGATTTATTTCGAAGCTTATAATCCGAACCCATGTTGGAGTCCTTACAAGGTCAGCCAGACATGTCCACTCTTA
TGGGATGTCCTGGGCTTCCCCACAGACCTTGCCTATCAACCCGGTCCCTCAACCTATTTCAACCGCACGGATGTG
AAGAGCGCTCTGCATGTTCCTCTCGATATCGACTGGGAGCTCTGTAGCATCGAAAGCGTCTTTGTGGGCGTCAAC
CCGGGGCCCGAGCAACAGTACGACGAGTCTGCGAATCCCACAGAGCATGTCCTGCCGCGACTGATCGAGGCGACT
AATCGGGTCTTGATCTCGAATGGAGATTGGGACTATCTGATCATCACGAATGGAACGTTGCTGGCGATCCAGAAC
ATGACCTGGAATGGCGAGCTGGGTTTCCAGACTCGTCCCACCACTCCCATTACTATTGACACGTCCGACTTGCAA
TACGCTCCGGTCTTCACTGCCCAAGACGATTATGGCGGTTTGGATGGTCCACAGGGGTTGATGGGAGTCCAGCAC
TATGAACGTGGTCTGATGTTTGCGGAAACCTTCCAAGCGGGTCATCGACAATCCCAGGATCAAGGCCGAATGTCT
TATCGTCATGTCCAGTGGTTGTTGGGTGATGTTGAGCGTCTTTGA
Gene >Pro_DTO377G3_2|g4615.t1
ATGTTCGGTCGATCGATCTCAGCAGTTCTGGCGATCGCACTGCTGATCAATGGCAACGAAGCACGACAGCCGACT
CGAGGCCCTTCTACGCGTCCTACCCAGCAGTCTGAACCAATTGATCCCTCAAACTATCGATTTTTAACTAACGAG
ACTAAATGTATGCTTTACTCCAATCCTTTACCCATTCCTTCAACCACGGCTGACAAATAATGTTTCCACAGCCCA
TGTCGTGGAGAGTCTACCGGACGTTAATTTCGATTTGGGAGAGATGTACTCGGGGTTTATCCCTGTCCGTGACGA
TGCCTCCTTGTTCTACATATTCCAGCCGAAGATCGGGGAACCAAGCGACGACCTTACAATTTGGCTGAATGGTGG
ACCGGGATGTAGTTCAATGCAGGGGTTTCTGCAGGAGAACGGGCGCTTCACCTGGCAACCTGGTACCTACGAACC
TGTCATCAATGAGTACTCATGGGTTAATTTAACCAATATGTTATGGTACGTCATTAGTAAAATGGTTTCTTTGTG
TGCAGACCCGAGGATGTACTTGATAAGCTGACAGGTGTTTAGGGTCGACCAACCGGTTGGAGTTGGGTTCTCAAA
CGGCACGCCGACTGCAACCGACGAGGAGGACATCGCTGCCGATTTCGTCAACTTTTTCCAAGAGTTCCAAAAAAC
ATACGGTATTAAGAACTTTCGAATCTTCTTAACTGGTGAGAGTTATGCGGGCCGGTACGTGCCCTTCATATCCGC
CGCCATGCTCGACAAGAATGATACCGAGTACTTCAACCTCAGCGGTAAGACTTGAGAATCCCCCTGAATCTGCAT
TATATCGGTCGCACATACTCATCCCATACTAGGAGCCCTGATGTATGATGCGTGCATCGGCCAGTGGGATTATAT
CCAGGCCGAACTCCCCTCCTACCCCTTCGTTGAACAACATGCCGAGCTCTTCAACTTTAACCAATCGTACATGGG
GGAGCTGCAAGCTACCTACGAAGAATGCGGTTACAAGGAATACTTCGAGGAGTATTTCACCTATCCGGCCTCTGG
AGTGCAACCCTCCAAACAAATGAACTACTCCGAGTGCGACATCTACAACATGATTTATTTCGAAGCTTATAATCC
GAACCCATGTTGGAGTCCTTACAAGGTCAGCCAGACATGTCCACTCTTATGGGATGTCCTGGGCTTCCCCACAGA
CCTTGCCTATCAACCCGGTCCCTCAACCTATTTCAACCGCACGGATGTGAAGAGCGCTCTGCATGTTCCTCTCGA
TATCGACTGGGAGCTCTGTAGCATCGAAAGCGTCTTTGTGGGCGTCAACCCGGGGCCCGAGCAACAGTACGACGA
GTCTGCGAATCCCACAGAGCATGTCCTGCCGCGACTGATCGAGGCGACTAATCGGGTCTTGATCTCGAATGGAGA
TTGGGACTATCTGATCATCACGAATGGAACGTTGCTGGCGATCCAGAACATGACCTGGAATGGCGAGCTGGGTTT
CCAGACTCGTCCCACCACTCCCATTACTATTGACACGTCCGACTTGCAATACGCTCCGGTCTTCACTGCCCAAGA
CGATTATGGCGGTTTGGATGGTCCACAGGGGTTGATGGGAGTCCAGCACTATGAACGTGGTCTGATGTTTGCGGA
AACCTTCCAAGCGGGTCATCGACAATCCCAGGATCAAGGCCGAATGTCTTATCGTCATGTCCAGTGGTTGTTGGG
TGATGTTGAGCGTCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail