Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4605.t1
Gene name
Locationscaffold_09:655827..658436
Strand+
Gene length (bp)2609
Transcript length (bp)2493
Coding sequence length (bp)2493
Protein length (aa) 831

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 2.4E-13 752 796
PF12678 zf-rbx1 RING-H2 zinc finger domain 9.5E-10 766 796
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.0E-09 752 795
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.3E-07 753 795
PF17123 zf-RING_11 RING-like zinc finger 2.1E-07 753 781
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 5.7E-05 769 797

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0005680 anaphase-promoting complex Yes
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:1902494 catalytic complex No
GO:0044464 cell part No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0140096 catalytic activity, acting on a protein No
GO:0043169 cation binding No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0016740 transferase activity No
GO:0044446 intracellular organelle part No
GO:0003824 catalytic activity No
GO:1990234 transferase complex No
GO:0044424 intracellular part No
GO:0000151 ubiquitin ligase complex No
GO:0046914 transition metal ion binding No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0044428 nuclear part No
GO:0044422 organelle part No
GO:0000152 nuclear ubiquitin ligase complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4605.t1
MGQSSSTQRDPSNNGYRVHFAPFSIQRGPNTRDENMNHRQAAEHNGEGGLPPRPDMNIHNRSDQDMASDRPGRTS
AGGSQPMRSIEEEGGPEYELPPREYRTAAFARMAARRQSTMSRLGSRLLPNSVIRGLLNSQEETPAEGHAHRHGL
VSPRAETAQTSGRFSAFDSFGSRGITRRRSARAPYFIPPRPESAGIPDAPATPTYIDSPSQIPDPTRASWRRSVR
LQRMRHSISSPISHMFGQPHSDLRPHESPEYPMSDPLFDDRAMDTRLDFGETPHELESLEPSIQAERPVTDSSSA
QPSPALMRRLPGIIRARSSRVLRREEQTPLSRVLQLAASAIAAQLSGTAGPALPNIQALGNDGLDGSLENFIQSL
QHATSAQAQPPAADGSSSTANEGPSHPVNFLRVFRFANSEPSTSGAARQSASGVGDHGTQTDGMDIDEPAEGAGR
TVTLVVVGVRSVLAGNAGHTEQQQPVSPGPGLDALLGLPFLPHNTTIPRPQDATGEPTQRSDGRSRLTLPRNPTG
ATELPRPSVPNHFRRMSDTGPRAGFPSYHPSGFSESPPGPHPPPSTPAEQGISALSSGTSTPSRRPSSASAIAPD
ILPHLHEGQAMRPTAETLDEPVTFNTARQRRRSDSEYARHRALGSGAVRRNGMVEPDQPPPSGGRSWLIYVVGTN
LSENHPALTTPSLFTDNPTYEDMILLSSLLGPAKPPVASQTDINSAGGIFRLVEYAGSLVAEAVEGAASIQIQDG
ERCLICLSDYEVAEEVRELNKCKHVFHKDCIDQWLTTGRNSCPLCRGQGVNETPSNDSNTDNSVPSPAPAPAPAP
DGTAV*
Coding >Pro_DTO377G3_2|g4605.t1
ATGGGACAGTCCTCTTCTACACAACGTGATCCATCCAATAACGGCTATCGAGTACACTTTGCACCTTTCTCAATA
CAGCGTGGCCCTAACACGAGGGATGAAAACATGAATCATAGACAGGCGGCTGAACACAACGGAGAGGGTGGTTTG
CCACCCCGGCCAGACATGAACATACATAATAGGAGTGACCAAGATATGGCATCCGACCGGCCAGGCCGAACCTCC
GCTGGGGGCTCACAACCTATGCGAAGTATCGAAGAGGAGGGCGGGCCCGAATATGAGCTCCCACCCCGCGAATAC
CGCACTGCGGCGTTTGCTCGAATGGCAGCACGAAGACAATCGACCATGTCAAGACTGGGCTCTAGGCTTCTTCCA
AATTCAGTCATTCGTGGACTTCTCAACAGTCAAGAAGAGACCCCGGCCGAGGGACATGCACATCGACACGGCCTA
GTCTCTCCAAGAGCTGAGACTGCTCAAACATCCGGTCGGTTCAGTGCGTTCGATTCATTCGGCTCCAGAGGAATT
ACTCGGCGCCGATCTGCTCGCGCGCCATATTTCATTCCACCCCGTCCGGAGTCTGCTGGGATCCCAGATGCACCA
GCAACCCCGACATACATCGACTCTCCATCTCAAATACCTGACCCGACAAGAGCATCCTGGCGTCGCAGTGTCAGG
CTACAACGCATGCGTCATTCGATTTCATCTCCCATTTCTCACATGTTCGGCCAGCCACACTCAGATTTGCGGCCG
CACGAAAGCCCGGAATACCCAATGTCAGATCCTTTATTTGATGATAGGGCTATGGACACGCGTCTGGACTTCGGC
GAAACCCCCCATGAACTTGAATCACTAGAACCATCAATCCAGGCTGAGAGGCCGGTAACTGATTCGTCTTCTGCG
CAGCCGAGTCCTGCTTTGATGCGCCGATTGCCTGGGATCATCCGAGCAAGATCATCCAGAGTCCTGCGACGAGAG
GAGCAAACACCTCTGTCAAGGGTCCTTCAGCTCGCCGCATCCGCAATTGCAGCTCAGCTGTCCGGCACTGCCGGT
CCTGCGTTGCCTAACATCCAGGCATTGGGCAATGACGGGTTAGATGGCTCTTTGGAGAATTTCATCCAGAGTTTG
CAGCACGCGACTTCTGCGCAGGCTCAACCGCCTGCAGCAGACGGGTCGAGCAGTACTGCAAACGAAGGACCCTCG
CATCCCGTCAATTTCTTGCGTGTGTTCCGATTTGCCAATTCAGAACCATCCACAAGCGGCGCTGCAAGGCAGAGC
GCGAGTGGTGTCGGCGACCATGGGACCCAAACCGATGGAATGGACATCGACGAGCCTGCTGAAGGCGCAGGGCGA
ACGGTTACACTGGTTGTCGTTGGAGTTCGGTCCGTCCTGGCCGGAAACGCAGGTCATACCGAACAGCAACAGCCC
GTAAGTCCGGGCCCAGGTCTAGATGCTCTGCTTGGTCTGCCATTTTTGCCACATAATACTACTATCCCACGGCCT
CAAGATGCCACTGGTGAACCTACCCAACGGAGCGATGGGCGATCTAGATTGACTCTTCCTCGGAACCCCACCGGA
GCTACAGAACTTCCACGCCCGTCAGTTCCCAATCACTTTAGAAGAATGTCTGATACCGGCCCCCGTGCTGGATTC
CCATCCTATCATCCGTCTGGTTTCTCTGAAAGTCCCCCGGGGCCACACCCGCCTCCGTCAACACCAGCTGAACAG
GGGATATCTGCTTTATCCTCCGGCACTTCGACTCCGAGCCGTAGACCATCCTCCGCTTCAGCAATTGCTCCTGAT
ATTCTGCCCCATCTACATGAAGGCCAGGCAATGCGACCGACGGCGGAGACTCTGGATGAGCCTGTGACATTCAAT
ACCGCTCGCCAGCGACGTCGAAGCGATTCTGAGTATGCTCGTCATCGGGCCCTCGGCTCTGGTGCTGTTCGACGC
AATGGCATGGTTGAACCCGATCAACCCCCACCAAGTGGAGGTCGCAGTTGGTTAATTTATGTTGTTGGAACCAAC
CTTTCTGAAAACCACCCGGCTTTGACCACACCTAGTCTTTTCACCGATAACCCAACCTACGAGGATATGATCCTA
CTTTCATCACTATTAGGTCCAGCTAAACCCCCTGTCGCCTCTCAGACCGATATCAACTCCGCCGGCGGAATATTC
CGTCTTGTCGAGTATGCAGGTTCATTGGTCGCCGAAGCCGTCGAAGGCGCTGCCTCCATTCAAATCCAAGATGGG
GAGCGCTGTTTGATATGCTTGAGTGATTATGAGGTGGCGGAAGAAGTTCGAGAGCTGAATAAATGCAAACATGTC
TTCCACAAGGATTGCATAGACCAGTGGTTAACCACTGGGAGAAACTCTTGTCCTCTCTGCCGAGGTCAAGGCGTC
AACGAAACCCCCAGCAACGACTCCAATACCGACAACTCGGTACCCAGTCCTGCCCCTGCTCCGGCTCCGGCTCCA
GATGGCACAGCTGTCTGA
Transcript >Pro_DTO377G3_2|g4605.t1
ATGGGACAGTCCTCTTCTACACAACGTGATCCATCCAATAACGGCTATCGAGTACACTTTGCACCTTTCTCAATA
CAGCGTGGCCCTAACACGAGGGATGAAAACATGAATCATAGACAGGCGGCTGAACACAACGGAGAGGGTGGTTTG
CCACCCCGGCCAGACATGAACATACATAATAGGAGTGACCAAGATATGGCATCCGACCGGCCAGGCCGAACCTCC
GCTGGGGGCTCACAACCTATGCGAAGTATCGAAGAGGAGGGCGGGCCCGAATATGAGCTCCCACCCCGCGAATAC
CGCACTGCGGCGTTTGCTCGAATGGCAGCACGAAGACAATCGACCATGTCAAGACTGGGCTCTAGGCTTCTTCCA
AATTCAGTCATTCGTGGACTTCTCAACAGTCAAGAAGAGACCCCGGCCGAGGGACATGCACATCGACACGGCCTA
GTCTCTCCAAGAGCTGAGACTGCTCAAACATCCGGTCGGTTCAGTGCGTTCGATTCATTCGGCTCCAGAGGAATT
ACTCGGCGCCGATCTGCTCGCGCGCCATATTTCATTCCACCCCGTCCGGAGTCTGCTGGGATCCCAGATGCACCA
GCAACCCCGACATACATCGACTCTCCATCTCAAATACCTGACCCGACAAGAGCATCCTGGCGTCGCAGTGTCAGG
CTACAACGCATGCGTCATTCGATTTCATCTCCCATTTCTCACATGTTCGGCCAGCCACACTCAGATTTGCGGCCG
CACGAAAGCCCGGAATACCCAATGTCAGATCCTTTATTTGATGATAGGGCTATGGACACGCGTCTGGACTTCGGC
GAAACCCCCCATGAACTTGAATCACTAGAACCATCAATCCAGGCTGAGAGGCCGGTAACTGATTCGTCTTCTGCG
CAGCCGAGTCCTGCTTTGATGCGCCGATTGCCTGGGATCATCCGAGCAAGATCATCCAGAGTCCTGCGACGAGAG
GAGCAAACACCTCTGTCAAGGGTCCTTCAGCTCGCCGCATCCGCAATTGCAGCTCAGCTGTCCGGCACTGCCGGT
CCTGCGTTGCCTAACATCCAGGCATTGGGCAATGACGGGTTAGATGGCTCTTTGGAGAATTTCATCCAGAGTTTG
CAGCACGCGACTTCTGCGCAGGCTCAACCGCCTGCAGCAGACGGGTCGAGCAGTACTGCAAACGAAGGACCCTCG
CATCCCGTCAATTTCTTGCGTGTGTTCCGATTTGCCAATTCAGAACCATCCACAAGCGGCGCTGCAAGGCAGAGC
GCGAGTGGTGTCGGCGACCATGGGACCCAAACCGATGGAATGGACATCGACGAGCCTGCTGAAGGCGCAGGGCGA
ACGGTTACACTGGTTGTCGTTGGAGTTCGGTCCGTCCTGGCCGGAAACGCAGGTCATACCGAACAGCAACAGCCC
GTAAGTCCGGGCCCAGGTCTAGATGCTCTGCTTGGTCTGCCATTTTTGCCACATAATACTACTATCCCACGGCCT
CAAGATGCCACTGGTGAACCTACCCAACGGAGCGATGGGCGATCTAGATTGACTCTTCCTCGGAACCCCACCGGA
GCTACAGAACTTCCACGCCCGTCAGTTCCCAATCACTTTAGAAGAATGTCTGATACCGGCCCCCGTGCTGGATTC
CCATCCTATCATCCGTCTGGTTTCTCTGAAAGTCCCCCGGGGCCACACCCGCCTCCGTCAACACCAGCTGAACAG
GGGATATCTGCTTTATCCTCCGGCACTTCGACTCCGAGCCGTAGACCATCCTCCGCTTCAGCAATTGCTCCTGAT
ATTCTGCCCCATCTACATGAAGGCCAGGCAATGCGACCGACGGCGGAGACTCTGGATGAGCCTGTGACATTCAAT
ACCGCTCGCCAGCGACGTCGAAGCGATTCTGAGTATGCTCGTCATCGGGCCCTCGGCTCTGGTGCTGTTCGACGC
AATGGCATGGTTGAACCCGATCAACCCCCACCAAGTGGAGGTCGCAGTTGGTTAATTTATGTTGTTGGAACCAAC
CTTTCTGAAAACCACCCGGCTTTGACCACACCTAGTCTTTTCACCGATAACCCAACCTACGAGGATATGATCCTA
CTTTCATCACTATTAGGTCCAGCTAAACCCCCTGTCGCCTCTCAGACCGATATCAACTCCGCCGGCGGAATATTC
CGTCTTGTCGAGTATGCAGGTTCATTGGTCGCCGAAGCCGTCGAAGGCGCTGCCTCCATTCAAATCCAAGATGGG
GAGCGCTGTTTGATATGCTTGAGTGATTATGAGGTGGCGGAAGAAGTTCGAGAGCTGAATAAATGCAAACATGTC
TTCCACAAGGATTGCATAGACCAGTGGTTAACCACTGGGAGAAACTCTTGTCCTCTCTGCCGAGGTCAAGGCGTC
AACGAAACCCCCAGCAACGACTCCAATACCGACAACTCGGTACCCAGTCCTGCCCCTGCTCCGGCTCCGGCTCCA
GATGGCACAGCTGTCTGA
Gene >Pro_DTO377G3_2|g4605.t1
ATGGGACAGTCCTCTTCTACACAACGTGATCCATCCAATAACGGCTATCGAGTACACTTTGCACCTTTCTCAATA
CAGCGTGGCCCTAACACGAGGGATGAAAACATGAATCATAGACAGGCGGCTGAACACAACGGAGAGGGTGGTTTG
CCACCCCGGCCAGACATGAACATACATAATAGGAGTGACCAAGATATGGCATCCGACCGGCCAGGCCGAACCTCC
GCTGGGGGCTCACAACCTATGCGAAGTATCGAAGAGGAGGGCGGGCCCGAATATGAGCTCCCACCCCGCGAATAC
CGCACTGCGGCGTTTGCTCGAATGGCAGCACGAAGACAATCGACCATGTCAAGACTGGGCTCTAGGCTTCTTCCA
AATTCAGTCATTCGTGGACTTCTCAACAGTCAAGAAGAGACCCCGGCCGAGGGACATGCACATCGACACGGCCTA
GTCTCTCCAAGAGCTGAGACTGCTCAAACATCCGGTCGGTTCAGTGCGTTCGATTCATTCGGCTCCAGAGGAATT
ACTCGGCGCCGATCTGCTCGCGCGCCATATTTCATTCCACCCCGTCCGGAGTCTGCTGGGATCCCAGATGCACCA
GCAACCCCGACATACATCGACTCTCCATCTCAAATACCTGACCCGACAAGAGCATCCTGGCGTCGCAGTGTCAGG
CTACAACGCATGCGTCATTCGATTTCATCTCCCATTTCTCACATGTTCGGCCAGCCACACTCAGATTTGCGGCCG
CACGAAAGCCCGGAATACCCAATGTCAGATCCTTTATTTGATGATAGGGCTATGGACACGCGTCTGGACTTCGGC
GAAACCCCCCATGAACTTGAATCACTAGAACCATCAATCCAGGCTGAGAGGCCGGTAACTGATTCGTCTTCTGCG
CAGCCGAGTCCTGCTTTGATGCGCCGATTGCCTGGGATCATCCGAGCAAGATCATCCAGAGTCCTGCGACGAGAG
GAGCAAACACCTCTGTCAAGGGTCCTTCAGCTCGCCGCATCCGCAATTGCAGCTCAGCTGTCCGGCACTGCCGGT
CCTGCGTTGCCTAACATCCAGGCATTGGGCAATGACGGGTTAGATGGCTCTTTGGAGAATTTCATCCAGAGTTTG
CAGCACGCGACTTCTGCGCAGGCTCAACCGCCTGCAGCAGACGGGTCGAGCAGTACTGCAAACGAAGGACCCTCG
CATCCCGTCAATTTCTTGCGTGTGTTCCGATTTGCCAATTCAGAACCATCCACAAGCGGCGCTGCAAGGCAGAGC
GCGAGTGGTGTCGGCGACCATGGGACCCAAACCGATGGAATGGACATCGACGAGCCTGCTGAAGGCGCAGGGCGA
ACGGTTACACTGGTTGTCGTTGGAGTTCGGTCCGTCCTGGCCGGAAACGCAGGTCATACCGAACAGCAACAGCCC
GTAAGTCCGGGCCCAGGTCTAGATGCTCTGCTTGGTCTGCCATTTTTGCCACATAATACTACTATCCCACGGCCT
CAAGATGCCACTGGTGAACCTACCCAACGGAGCGATGGGCGATCTAGATTGACTCTTCCTCGGAACCCCACCGGA
GCTACAGAACTTCCACGCCCGTCAGTTCCCAATCACTTTAGAAGAATGTCTGATACCGGCCCCCGTGCTGGATTC
CCATCCTATCATCCGTCTGGTTTCTCTGAAAGTCCCCCGGGGCCACACCCGCCTCCGTCAACACCAGCTGAACAG
GGGATATCTGCTTTATCCTCCGGCACTTCGACTCCGAGCCGTAGACCATCCTCCGCTTCAGCAATTGCTCCTGAT
ATTCTGCCCCATCTACATGAAGGCCAGGCAATGCGACCGACGGCGGAGACTCTGGATGAGCCTGTGACATTCAAT
ACCGCTCGCCAGCGACGTCGAAGCGATTCTGAGTATGCTCGTCATCGGGCCCTCGGCTCTGGTGCTGTTCGACGC
AATGGCATGGTTGAACCCGATCAACCCCCACCAAGTGGAGGTCGCAGTTGGTTAATTTATGTTGTTGGAACCAAC
CTTTCTGAAAACCACCCGGCTTTGACCACACCTAGTCTTTTCACCGATGTAAGAATGCCCTACTACTCGGTTTTG
TCAGGAACATGATGACTAATACTTTAAACAGAACCCAACCTACGAGGATATGATCCTACTTTCATCACTATTAGG
TCCAGCTAAACCCCCTGTCGCCTCTCAGACCGATATCAACTCCGCCGGCGGAATATTCCGTCTTGTCGAGTATGC
AGGTTCATTGGTCGCCGAAGCCGTCGAAGGCGCTGCCTCCATTCAAATCCAAGATGGGGAGCGCTGTTTGATATG
CTTGAGTGATTATGAGGTGGCGGAAGAAGTTCGAGAGCTGAATAAATGCAAACATGTCTTCCACAAGGATTGCAT
AGACCAGGTTTGTTGCCTCTGTCCATTCGATTTCAATCTGTTCGCTTGCTGACCGTATTTCGTAGTGGTTAACCA
CTGGGAGAAACTCTTGTCCTCTCTGCCGAGGTCAAGGCGTCAACGAAACCCCCAGCAACGACTCCAATACCGACA
ACTCGGTACCCAGTCCTGCCCCTGCTCCGGCTCCGGCTCCAGATGGCACAGCTGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail