Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4583.t1
Gene name
Locationscaffold_09:611738..613329
Strand-
Gene length (bp)1591
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01180 DHO_dh Dihydroorotate dehydrogenase 5.8E-55 150 434
PF01180 DHO_dh Dihydroorotate dehydrogenase 1.1E-09 459 508

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0016491 oxidoreductase activity No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 78 95 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 44.54 26.29 62.79
5d_25C Five days - 25 degrees Celsius 27.29 14.70 39.87
7d_25C Seven days - 25 degrees Celsius 21.37 11.04 31.70
10d_25C Ten days - 25 degrees Celsius 19.65 9.91 29.39
7d_15C Seven days - 15 degrees Celsius 31.21 17.46 44.97
7d_30C Seven days - 30 degrees Celsius 26.41 14.27 38.56

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.041016 yes
3d_25C 7d_25C 0.002297 yes
3d_25C 7d_15C 0.129711 no
3d_25C 7d_30C 0.020660 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.423674 no
5d_25C 7d_15C 0.679327 no
5d_25C 7d_30C 0.935911 no
5d_25C 10d_25C 0.237804 no
7d_25C 7d_15C 0.150197 no
7d_25C 7d_30C 0.496487 no
7d_25C 10d_25C 0.829044 no
7d_15C 7d_30C 0.586445 no
7d_15C 10d_25C 0.066479 no
7d_30C 10d_25C 0.301341 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4583.t1
MAWRASVRARALPTSRLIQRPSALLPKRAQRYPGALRYASDSAAPPPTEAAKEMGKEVTQEAAKEIPRKARRGSR
KALYGASLALTLLVGYIYGTDTRASIHRYGVVPLIRLLWPDAEDAHHVGVENLKMLYQYGLHPRERGDPDSDGVL
ATEVFGYTLSNPIGISAGLDKHAEVPDALFDIGPAIVEVGGTTPLPQEGNPKPRVFRLPSQHAMINRYGLNSKGA
DHMAKVLKQRVADFAYAAGFGLHEQSAQRVLDGEANVPPGSLVPGKLLAVQVAKNKVTPDGDIEAIKRDYVYCVD
RVAPYADILVVNVSSPNTPGLRDLQAAAPLTAILTAVVASAKNVERKTKPYVMVKVSPDEDSDEQISGICEAVWN
SGVDGVIVGNTTNRRPDPVPRGFVLPAEEQKTLKETGGYSGPQLFNRSIALVARYRALLDQGPPSSATNSDKSVG
KVSGLPRKVIFASGGITTGEEAREALKAGASVAMMYTGIVYGGVGTVTRVKQELREELQKK*
Coding >Pro_DTO377G3_2|g4583.t1
ATGGCCTGGAGAGCCAGCGTCCGGGCTCGCGCTCTTCCTACCTCCCGCTTGATCCAACGGCCGTCGGCATTGCTA
CCGAAACGGGCCCAGCGCTACCCCGGTGCTTTGCGATATGCTTCGGACTCGGCTGCACCTCCACCCACTGAGGCG
GCCAAGGAGATGGGAAAGGAAGTTACGCAGGAGGCCGCTAAGGAGATCCCCCGCAAAGCCCGCCGTGGCTCTAGG
AAGGCTTTGTACGGTGCCTCATTGGCCTTAACCCTGCTGGTGGGCTACATCTATGGAACGGACACCAGAGCCAGT
ATCCACAGATACGGCGTTGTACCCTTGATCCGCCTTTTGTGGCCCGATGCGGAGGATGCGCACCACGTTGGCGTG
GAAAACCTGAAGATGCTCTACCAATATGGTCTGCACCCACGCGAGCGTGGCGACCCGGACAGTGATGGTGTCCTG
GCAACTGAGGTCTTTGGATACACCCTCTCTAACCCCATCGGTATCTCCGCCGGTCTGGACAAGCACGCCGAGGTC
CCTGATGCGCTGTTCGACATCGGTCCTGCCATCGTCGAGGTGGGCGGCACGACCCCTCTACCACAGGAAGGCAAC
CCGAAGCCTAGAGTATTCCGACTGCCCTCGCAACACGCGATGATCAACCGCTACGGCCTCAACTCCAAGGGCGCC
GACCATATGGCAAAGGTTCTGAAGCAGCGTGTAGCTGACTTCGCCTACGCCGCCGGATTTGGCCTGCACGAACAA
TCCGCGCAGCGCGTCTTGGACGGCGAAGCCAACGTTCCGCCCGGAAGTCTCGTCCCAGGCAAACTTCTTGCGGTG
CAAGTTGCCAAGAACAAGGTTACCCCCGACGGAGACATCGAAGCCATCAAGCGCGACTACGTTTACTGCGTGGAC
CGAGTGGCGCCGTACGCCGACATTCTCGTCGTGAACGTCTCCAGCCCCAACACCCCAGGTCTGCGTGACCTCCAA
GCAGCCGCACCCCTCACAGCAATCCTCACGGCGGTCGTCGCCTCCGCCAAGAACGTCGAGCGCAAGACCAAGCCC
TACGTAATGGTCAAGGTAAGCCCGGATGAAGACTCCGACGAGCAGATATCCGGCATCTGCGAGGCTGTCTGGAAC
TCCGGCGTCGACGGTGTCATCGTCGGCAACACCACCAACCGTCGGCCCGACCCCGTGCCCCGGGGCTTCGTCCTC
CCCGCCGAGGAGCAGAAGACTCTGAAGGAAACCGGCGGTTACTCCGGCCCCCAGCTGTTTAACCGCTCCATTGCG
CTCGTCGCCCGCTACCGCGCCCTGCTTGACCAGGGACCCCCATCATCTGCGACCAATTCGGATAAGTCTGTCGGG
AAGGTGTCTGGCCTTCCTCGGAAGGTTATCTTCGCTTCCGGCGGTATCACTACTGGTGAGGAGGCACGCGAGGCT
CTCAAGGCCGGCGCTTCGGTGGCTATGATGTACACTGGTATTGTCTACGGCGGTGTTGGCACTGTCACGCGTGTC
AAGCAGGAGCTGCGCGAGGAGCTGCAGAAGAAATAA
Transcript >Pro_DTO377G3_2|g4583.t1
ATGGCCTGGAGAGCCAGCGTCCGGGCTCGCGCTCTTCCTACCTCCCGCTTGATCCAACGGCCGTCGGCATTGCTA
CCGAAACGGGCCCAGCGCTACCCCGGTGCTTTGCGATATGCTTCGGACTCGGCTGCACCTCCACCCACTGAGGCG
GCCAAGGAGATGGGAAAGGAAGTTACGCAGGAGGCCGCTAAGGAGATCCCCCGCAAAGCCCGCCGTGGCTCTAGG
AAGGCTTTGTACGGTGCCTCATTGGCCTTAACCCTGCTGGTGGGCTACATCTATGGAACGGACACCAGAGCCAGT
ATCCACAGATACGGCGTTGTACCCTTGATCCGCCTTTTGTGGCCCGATGCGGAGGATGCGCACCACGTTGGCGTG
GAAAACCTGAAGATGCTCTACCAATATGGTCTGCACCCACGCGAGCGTGGCGACCCGGACAGTGATGGTGTCCTG
GCAACTGAGGTCTTTGGATACACCCTCTCTAACCCCATCGGTATCTCCGCCGGTCTGGACAAGCACGCCGAGGTC
CCTGATGCGCTGTTCGACATCGGTCCTGCCATCGTCGAGGTGGGCGGCACGACCCCTCTACCACAGGAAGGCAAC
CCGAAGCCTAGAGTATTCCGACTGCCCTCGCAACACGCGATGATCAACCGCTACGGCCTCAACTCCAAGGGCGCC
GACCATATGGCAAAGGTTCTGAAGCAGCGTGTAGCTGACTTCGCCTACGCCGCCGGATTTGGCCTGCACGAACAA
TCCGCGCAGCGCGTCTTGGACGGCGAAGCCAACGTTCCGCCCGGAAGTCTCGTCCCAGGCAAACTTCTTGCGGTG
CAAGTTGCCAAGAACAAGGTTACCCCCGACGGAGACATCGAAGCCATCAAGCGCGACTACGTTTACTGCGTGGAC
CGAGTGGCGCCGTACGCCGACATTCTCGTCGTGAACGTCTCCAGCCCCAACACCCCAGGTCTGCGTGACCTCCAA
GCAGCCGCACCCCTCACAGCAATCCTCACGGCGGTCGTCGCCTCCGCCAAGAACGTCGAGCGCAAGACCAAGCCC
TACGTAATGGTCAAGGTAAGCCCGGATGAAGACTCCGACGAGCAGATATCCGGCATCTGCGAGGCTGTCTGGAAC
TCCGGCGTCGACGGTGTCATCGTCGGCAACACCACCAACCGTCGGCCCGACCCCGTGCCCCGGGGCTTCGTCCTC
CCCGCCGAGGAGCAGAAGACTCTGAAGGAAACCGGCGGTTACTCCGGCCCCCAGCTGTTTAACCGCTCCATTGCG
CTCGTCGCCCGCTACCGCGCCCTGCTTGACCAGGGACCCCCATCATCTGCGACCAATTCGGATAAGTCTGTCGGG
AAGGTGTCTGGCCTTCCTCGGAAGGTTATCTTCGCTTCCGGCGGTATCACTACTGGTGAGGAGGCACGCGAGGCT
CTCAAGGCCGGCGCTTCGGTGGCTATGATGTACACTGGTATTGTCTACGGCGGTGTTGGCACTGTCACGCGTGTC
AAGCAGGAGCTGCGCGAGGAGCTGCAGAAGAAATAA
Gene >Pro_DTO377G3_2|g4583.t1
ATGGCCTGGAGAGCCAGCGTCCGGGCTCGCGCTCTTCCTACCTCCCGCTTGATCCAACGGCCGTCGGCATTGCTA
CCGAAACGGGCCCAGCGCTACCCCGGTGCTTTGCGATATGCTTCGGACTCGGCTGCACCTCCACCCACTGAGGCG
GCCAAGGAGATGGGAAAGGAAGTTACGCAGGAGGCCGCTAAGGAGATCCCCCGCAAAGCCCGCCGTGGCTCTAGG
AAGGCTTTGTACGGTGCCTCATTGGCCTTAACCCTGCTGGTGGGCTACATCTATGGAACGGACACCAGAGCCAGT
ATCCACAGATACGGCGTTGTACCCTTGATCCGCCTTTTGTGGCCCGATGCGGAGGATGCGCACCACGTTGGCGTG
GAAAACCTGAAGATGCTCTACCAATATGGTCTGCACCCACGCGAGCGTGGCGACCCGGACAGTGATGGTGTCCTG
GCAACTGAGGTAATGGTATTCCCAAACCTGCCGATGGTCAATCACTGACGAGGTCTTTTACCAGGTCTTTGGATA
CACCCTCTCTAACCCCATCGGTATCTCCGCCGGTCTGGACAAGCACGCCGAGGTCCCTGATGCGCTGTTCGACAT
CGGTCCTGCCATCGTCGAGGTGGGCGGCACGACCCCTCTACCACAGGAAGGCAACCCGAAGCCTAGAGTATTCCG
ACTGCCCTCGCAACACGCGATGATCAACCGCTACGGCCTCAACTCCAAGGGCGCCGACCATATGGCAAAGGTTCT
GAAGCAGCGTGTAGCTGACTTCGCCTACGCCGCCGGATTTGGCCTGCACGAACAATCCGCGCAGCGCGTCTTGGA
CGGCGAAGCCAACGTTCCGCCCGGAAGTCTCGTCCCAGGCAAACTTCTTGCGGTGCAAGTTGCCAAGAACAAGGT
TACCCCCGACGGAGACATCGAAGCCATCAAGCGCGACTACGTTTACTGCGTGGACCGAGTGGCGCCGTACGCCGA
CATTCTCGTCGTGAACGTCTCCAGCCCCAACACCCCAGGTCTGCGTGACCTCCAAGCAGCCGCACCCCTCACAGC
AATCCTCACGGCGGTCGTCGCCTCCGCCAAGAACGTCGAGCGCAAGACCAAGCCCTACGTAATGGTCAAGGTAAG
CCCGGATGAAGACTCCGACGAGCAGATATCCGGCATCTGCGAGGCTGTCTGGAACTCCGGCGTCGACGGTGTCAT
CGTCGGCAACACCACCAACCGTCGGCCCGACCCCGTGCCCCGGGGCTTCGTCCTCCCCGCCGAGGAGCAGAAGAC
TCTGAAGGAAACCGGCGGTTACTCCGGCCCCCAGCTGTTTAACCGCTCCATTGCGCTCGTCGCCCGCTACCGCGC
CCTGCTTGACCAGGGACCCCCATCATCTGCGACCAATTCGGATAAGTCTGTCGGGAAGGTGTCTGGCCTTCCTCG
GAAGGTTATCTTCGCTTCCGGCGGTATCACTACTGGTGAGGAGGCACGCGAGGCTCTCAAGGCCGGCGCTTCGGT
GGCTATGATGTACACTGGTATTGTCTACGGCGGTGTTGGCACTGTCACGCGTGTCAAGCAGGAGCTGCGCGAGGA
GCTGCAGAAGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail