Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4569.t1
Gene name
Locationscaffold_09:584461..585619
Strand+
Gene length (bp)1158
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22
2 78 95 17
3 107 129 22
4 149 171 22
5 183 205 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1.22 0.00 2.56
5d_25C Five days - 25 degrees Celsius 1.54 0.03 3.04
7d_25C Seven days - 25 degrees Celsius 1.91 0.10 3.72
10d_25C Ten days - 25 degrees Celsius 0.60 0.00 1.43
7d_15C Seven days - 15 degrees Celsius 0.82 0.00 1.80
7d_30C Seven days - 30 degrees Celsius 0.83 0.00 1.82

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.782856 no
3d_25C 7d_25C 0.528476 no
3d_25C 7d_15C 0.620247 no
3d_25C 7d_30C 0.638495 no
3d_25C 10d_25C 0.399726 no
5d_25C 7d_25C 0.771424 no
5d_25C 7d_15C 0.357538 no
5d_25C 7d_30C 0.372447 no
5d_25C 10d_25C 0.225167 no
7d_25C 7d_15C 0.187636 no
7d_25C 7d_30C 0.201629 no
7d_25C 10d_25C 0.132536 no
7d_15C 7d_30C 0.984784 no
7d_15C 10d_25C 0.752877 no
7d_30C 10d_25C 0.739098 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4569.t1
MVLTAAIFVTIRLATRIHLKKFGWDDLFLVIALAASVMTTIAVNLAVVHGYGRRKADMGEGIHIALKWFFVAQIP
YKIALGFTKASIVLLYLRVFITESFQRVGKGFLTVIAAWTVASVLVTIFQCIPIEASWNHNIKVKQCVDKDSWWY
AFAGINTVTDVLIAILPIPPVRHLKLSKRDRIGLCFVFGVGAFVCVTSIMRTVAVSQTSTGLDQSWDFIPRSVWT
LVECNMGIICACLPMMRRPLSFLFPWLFRGSSRNESERLSYVPIELRYTNRQLRPRGSQSQEEILQSDVRDKRAL
AAEE*
Coding >Pro_DTO377G3_2|g4569.t1
ATGGTGCTCACTGCGGCCATATTTGTTACCATTCGGCTAGCAACGAGGATTCATCTGAAAAAATTCGGTTGGGAT
GATCTGTTCCTCGTCATCGCCCTAGCGGCATCGGTCATGACAACAATTGCTGTCAATTTAGCCGTCGTGCATGGT
TATGGCAGGCGAAAAGCAGATATGGGAGAGGGTATACATATAGCTTTGAAGTGGTTTTTTGTTGCCCAGATTCCA
TATAAGATTGCCCTCGGCTTTACCAAAGCTTCTATCGTCCTCCTTTACCTCCGAGTATTTATCACAGAGTCTTTC
CAGCGCGTGGGAAAGGGTTTCCTAACCGTCATCGCCGCATGGACAGTCGCATCAGTCCTCGTCACAATCTTTCAG
TGTATCCCAATCGAAGCTTCTTGGAACCATAATATCAAAGTCAAACAATGCGTGGACAAAGATAGCTGGTGGTAT
GCATTTGCGGGAATTAACACGGTTACTGACGTTCTGATCGCCATTCTCCCCATTCCCCCAGTTCGCCACCTGAAG
CTCTCGAAGCGCGACCGGATTGGGTTGTGTTTTGTTTTCGGTGTTGGAGCATTTGTCTGCGTCACTAGTATCATG
CGTACGGTTGCAGTGTCTCAAACATCGACTGGCTTAGATCAAAGCTGGGATTTCATCCCTCGCTCAGTCTGGACT
CTCGTGGAGTGCAATATGGGAATAATCTGTGCGTGTCTCCCTATGATGCGCCGGCCGCTAAGTTTTCTGTTTCCG
TGGCTTTTCAGAGGCTCTTCTCGGAATGAATCAGAAAGACTTAGCTATGTTCCCATTGAGTTGAGGTATACAAAT
CGCCAACTGCGTCCGCGAGGGAGTCAAAGCCAGGAGGAAATTCTACAGTCAGATGTGCGAGATAAAAGGGCTTTG
GCGGCTGAGGAATAA
Transcript >Pro_DTO377G3_2|g4569.t1
ATGGTGCTCACTGCGGCCATATTTGTTACCATTCGGCTAGCAACGAGGATTCATCTGAAAAAATTCGGTTGGGAT
GATCTGTTCCTCGTCATCGCCCTAGCGGCATCGGTCATGACAACAATTGCTGTCAATTTAGCCGTCGTGCATGGT
TATGGCAGGCGAAAAGCAGATATGGGAGAGGGTATACATATAGCTTTGAAGTGGTTTTTTGTTGCCCAGATTCCA
TATAAGATTGCCCTCGGCTTTACCAAAGCTTCTATCGTCCTCCTTTACCTCCGAGTATTTATCACAGAGTCTTTC
CAGCGCGTGGGAAAGGGTTTCCTAACCGTCATCGCCGCATGGACAGTCGCATCAGTCCTCGTCACAATCTTTCAG
TGTATCCCAATCGAAGCTTCTTGGAACCATAATATCAAAGTCAAACAATGCGTGGACAAAGATAGCTGGTGGTAT
GCATTTGCGGGAATTAACACGGTTACTGACGTTCTGATCGCCATTCTCCCCATTCCCCCAGTTCGCCACCTGAAG
CTCTCGAAGCGCGACCGGATTGGGTTGTGTTTTGTTTTCGGTGTTGGAGCATTTGTCTGCGTCACTAGTATCATG
CGTACGGTTGCAGTGTCTCAAACATCGACTGGCTTAGATCAAAGCTGGGATTTCATCCCTCGCTCAGTCTGGACT
CTCGTGGAGTGCAATATGGGAATAATCTGTGCGTGTCTCCCTATGATGCGCCGGCCGCTAAGTTTTCTGTTTCCG
TGGCTTTTCAGAGGCTCTTCTCGGAATGAATCAGAAAGACTTAGCTATGTTCCCATTGAGTTGAGGTATACAAAT
CGCCAACTGCGTCCGCGAGGGAGTCAAAGCCAGGAGGAAATTCTACAGTCAGATGTGCGAGATAAAAGGGCTTTG
GCGGCTGAGGAATAA
Gene >Pro_DTO377G3_2|g4569.t1
ATGGTGCTCACTGCGGCCATATTTGTTACCATTCGGCTAGCAACGAGGATTCATCTGAAAAAATTCGGTTGGGAT
GATCTGTTCCTCGTCATCGCCCTAGCGGCATCGGTCATGACAACAATTGCTGTCAATTTAGGTAAGTCAAAAGAC
ATCTGATGGCGGGTCTTTTAGTCACAAGCTGACCTTTGGTTTCCAGCCGTCGTGCATGGTTATGGCAGGCGAAAA
GCAGATATGGGAGAGGGTATACATATAGCTTTGAAGGTGCAGTGATATCAACGGTAGCTAATGCTCGTTCAAATC
TCTAACACTCCCCGAAGTGGTTTTTTGTTGCCCAGATTCCATATAAGATTGCCCTCGGCTTTACCAAAGCTTCTA
TCGTCCTCCTTTACCTCCGAGTATTTATCACAGAGTCTTTCCAGCGCGTGGGAAAGGGTTTCCTAACCGTCATCG
CCGCATGGACAGTCGCATCAGTCCTCGTCACAATCTTTCAGTGTATCCCAATCGAAGCTTCTTGGAACCATAATA
TCAAAGTCAAACAATGCGTGGACAAAGATAGCTGGTGGTATGCATTTGCGGGAATTAACACGGTTACTGACGTTC
TGATCGCCATTCTCCCCATTCCCCCAGTTCGCCACCTGAAGCTCTCGAAGCGCGACCGGATTGGGTTGTGTTTTG
TTTTCGGTGTTGGAGCATTGTATGTATCATTTCATCCTCTCTTCTCTATGCATTAATCAGGAGTCTCATGTGTAC
ATAGTGTCTGCGTCACTAGTATCATGCGTACGGTTGCAGTGTCTCAAACATCGACTGGCTTAGATCAAAGCTGTG
AGTATCTTGGGAGCCTCGAAAAAAGGGAATGCAGAGAACAGTTGCTGATCAAATTTTACTATAGGGGATTTCATC
CCTCGCTCAGTCTGGACTCTCGTGGAGTGCAATATGGGAATAATCTGTGCGTGTCTCCCTATGATGCGCCGGCCG
CTAAGTTTTCTGTTTCCGTGGCTTTTCAGAGGCTCTTCTCGGAATGAATCAGAAAGACTTAGCTATGTTCCCATT
GAGTTGAGGTATACAAATCGCCAACTGCGTCCGCGAGGGAGTCAAAGCCAGGAGGAAATTCTACAGTCAGATGTG
CGAGATAAAAGGGCTTTGGCGGCTGAGGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail