Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4567.t1
Gene name
Locationscaffold_09:580723..581734
Strand+
Gene length (bp)1011
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 2.6E-42 74 306
PF20434 BD-FAE BD-FAE 3.1E-20 68 214

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 257.71 156.50 358.93
5d_25C Five days - 25 degrees Celsius 412.38 242.24 582.53
7d_25C Seven days - 25 degrees Celsius 489.83 280.10 699.57
10d_25C Ten days - 25 degrees Celsius 803.89 445.86 1161.92
7d_15C Seven days - 15 degrees Celsius 330.08 194.21 465.96
7d_30C Seven days - 30 degrees Celsius 464.24 264.19 664.30

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.026091 yes
3d_25C 7d_25C 0.003625 yes
3d_25C 7d_15C 0.299545 no
3d_25C 7d_30C 0.004840 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.545491 no
5d_25C 7d_15C 0.383303 no
5d_25C 7d_30C 0.689648 no
5d_25C 10d_25C 0.003197 yes
7d_25C 7d_15C 0.084587 no
7d_25C 7d_30C 0.877042 no
7d_25C 10d_25C 0.032406 yes
7d_15C 7d_30C 0.143169 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.016098 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4567.t1
MASSRWWLYVQAIFWRFLMRIGMFLHEIGPRPPRPLFTRTVISDSHCHPVVLHFYCPPDYPEQRRLGHRFPVAVN
FHGGGFTLGAATDDSRWAKMVLEDTGAVMVSVGYRRAPEHPFPAAVDDGVEALLYLATHASELGLDVSRVALSGF
SAGGNLAVTVPLRLRGRISTEVKEHLGRAESTQNLLSQVGDLHIVALFSWYPILDFEESRDHRRAMSLMPDKTLP
AFFTTLFDEAYLPDLDERISPYASPIHASDRILSEALPRDVFFFICEWDMLMKEGQSFVRRLESLGKRPRAMLIE
KARHAWDKSPNPWRDQNRVDLLYRDACADMKAIFDR*
Coding >Pro_DTO377G3_2|g4567.t1
ATGGCTTCGTCTCGTTGGTGGCTGTATGTACAGGCCATATTTTGGCGGTTTCTGATGCGCATTGGCATGTTCTTG
CACGAGATTGGTCCGCGCCCACCCCGACCGTTATTCACCCGTACCGTGATATCCGACTCCCATTGCCATCCGGTC
GTCCTCCACTTTTACTGTCCACCGGATTATCCAGAGCAGCGAAGGCTAGGCCATCGCTTCCCTGTCGCTGTGAAC
TTCCACGGAGGCGGTTTCACGCTCGGTGCTGCTACCGATGATTCTCGCTGGGCGAAAATGGTGCTGGAGGATACC
GGCGCCGTGATGGTGAGTGTCGGCTACCGGCGAGCCCCCGAACACCCTTTTCCTGCGGCAGTAGACGACGGAGTC
GAGGCCCTACTGTACCTGGCAACACATGCCAGTGAACTGGGATTGGATGTGAGCCGAGTGGCGTTGAGCGGGTTC
TCGGCAGGCGGCAACCTGGCTGTCACGGTGCCCTTGCGACTGCGTGGCAGAATATCCACCGAAGTGAAGGAACAT
TTGGGTCGAGCCGAATCCACGCAAAATCTGCTCAGTCAGGTCGGCGATCTTCACATCGTTGCATTGTTCTCTTGG
TATCCGATTCTGGACTTTGAAGAATCTCGCGATCACCGTCGCGCTATGAGTCTGATGCCGGACAAGACTCTCCCT
GCATTTTTCACCACACTCTTTGATGAGGCCTATCTTCCTGATTTGGACGAACGTATATCCCCCTATGCATCTCCC
ATCCACGCATCTGACCGTATCCTGTCTGAAGCTCTTCCCCGCGACGTCTTTTTCTTTATTTGCGAATGGGATATG
TTGATGAAGGAGGGTCAATCTTTCGTTCGCCGATTAGAGAGCCTCGGTAAACGTCCTCGCGCCATGCTTATTGAG
AAAGCCCGGCATGCGTGGGATAAGTCACCTAATCCGTGGCGGGACCAAAATCGCGTGGACCTTTTATACCGCGAT
GCCTGTGCGGATATGAAGGCTATCTTTGACCGGTGA
Transcript >Pro_DTO377G3_2|g4567.t1
ATGGCTTCGTCTCGTTGGTGGCTGTATGTACAGGCCATATTTTGGCGGTTTCTGATGCGCATTGGCATGTTCTTG
CACGAGATTGGTCCGCGCCCACCCCGACCGTTATTCACCCGTACCGTGATATCCGACTCCCATTGCCATCCGGTC
GTCCTCCACTTTTACTGTCCACCGGATTATCCAGAGCAGCGAAGGCTAGGCCATCGCTTCCCTGTCGCTGTGAAC
TTCCACGGAGGCGGTTTCACGCTCGGTGCTGCTACCGATGATTCTCGCTGGGCGAAAATGGTGCTGGAGGATACC
GGCGCCGTGATGGTGAGTGTCGGCTACCGGCGAGCCCCCGAACACCCTTTTCCTGCGGCAGTAGACGACGGAGTC
GAGGCCCTACTGTACCTGGCAACACATGCCAGTGAACTGGGATTGGATGTGAGCCGAGTGGCGTTGAGCGGGTTC
TCGGCAGGCGGCAACCTGGCTGTCACGGTGCCCTTGCGACTGCGTGGCAGAATATCCACCGAAGTGAAGGAACAT
TTGGGTCGAGCCGAATCCACGCAAAATCTGCTCAGTCAGGTCGGCGATCTTCACATCGTTGCATTGTTCTCTTGG
TATCCGATTCTGGACTTTGAAGAATCTCGCGATCACCGTCGCGCTATGAGTCTGATGCCGGACAAGACTCTCCCT
GCATTTTTCACCACACTCTTTGATGAGGCCTATCTTCCTGATTTGGACGAACGTATATCCCCCTATGCATCTCCC
ATCCACGCATCTGACCGTATCCTGTCTGAAGCTCTTCCCCGCGACGTCTTTTTCTTTATTTGCGAATGGGATATG
TTGATGAAGGAGGGTCAATCTTTCGTTCGCCGATTAGAGAGCCTCGGTAAACGTCCTCGCGCCATGCTTATTGAG
AAAGCCCGGCATGCGTGGGATAAGTCACCTAATCCGTGGCGGGACCAAAATCGCGTGGACCTTTTATACCGCGAT
GCCTGTGCGGATATGAAGGCTATCTTTGACCGGTGA
Gene >Pro_DTO377G3_2|g4567.t1
ATGGCTTCGTCTCGTTGGTGGCTGTATGTACAGGCCATATTTTGGCGGTTTCTGATGCGCATTGGCATGTTCTTG
CACGAGATTGGTCCGCGCCCACCCCGACCGTTATTCACCCGTACCGTGATATCCGACTCCCATTGCCATCCGGTC
GTCCTCCACTTTTACTGTCCACCGGATTATCCAGAGCAGCGAAGGCTAGGCCATCGCTTCCCTGTCGCTGTGAAC
TTCCACGGAGGCGGTTTCACGCTCGGTGCTGCTACCGATGATTCTCGCTGGGCGAAAATGGTGCTGGAGGATACC
GGCGCCGTGATGGTGAGTGTCGGCTACCGGCGAGCCCCCGAACACCCTTTTCCTGCGGCAGTAGACGACGGAGTC
GAGGCCCTACTGTACCTGGCAACACATGCCAGTGAACTGGGATTGGATGTGAGCCGAGTGGCGTTGAGCGGGTTC
TCGGCAGGCGGCAACCTGGCTGTCACGGTGCCCTTGCGACTGCGTGGCAGAATATCCACCGAAGTGAAGGAACAT
TTGGGTCGAGCCGAATCCACGCAAAATCTGCTCAGTCAGGTCGGCGATCTTCACATCGTTGCATTGTTCTCTTGG
TATCCGATTCTGGACTTTGAAGAATCTCGCGATCACCGTCGCGCTATGAGTCTGATGCCGGACAAGACTCTCCCT
GCATTTTTCACCACACTCTTTGATGAGGCCTATCTTCCTGATTTGGACGAACGTATATCCCCCTATGCATCTCCC
ATCCACGCATCTGACCGTATCCTGTCTGAAGCTCTTCCCCGCGACGTCTTTTTCTTTATTTGCGAATGGGATATG
TTGATGAAGGAGGGTCAATCTTTCGTTCGCCGATTAGAGAGCCTCGGTAAACGTCCTCGCGCCATGCTTATTGAG
AAAGCCCGGCATGCGTGGGATAAGTCACCTAATCCGTGGCGGGACCAAAATCGCGTGGACCTTTTATACCGCGAT
GCCTGTGCGGATATGAAGGCTATCTTTGACCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail