Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4563.t1
Gene name
Locationscaffold_09:567145..571374
Strand-
Gene length (bp)4229
Transcript length (bp)3828
Coding sequence length (bp)3828
Protein length (aa) 1276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand 2.0E-11 137 224
PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand 8.2E-14 290 379
PF00627 UBA UBA/TS-N domain 9.8E-06 1239 1271

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 80.84 48.23 113.44
5d_25C Five days - 25 degrees Celsius 73.93 44.47 103.39
7d_25C Seven days - 25 degrees Celsius 62.51 37.95 87.08
10d_25C Ten days - 25 degrees Celsius 68.86 41.60 96.13
7d_15C Seven days - 15 degrees Celsius 87.12 51.14 123.11
7d_30C Seven days - 30 degrees Celsius 62.72 37.85 87.58

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.772564 no
3d_25C 7d_25C 0.278203 no
3d_25C 7d_15C 0.816456 no
3d_25C 7d_30C 0.290792 no
3d_25C 10d_25C 0.560091 no
5d_25C 7d_25C 0.517396 no
5d_25C 7d_15C 0.545065 no
5d_25C 7d_30C 0.532398 no
5d_25C 10d_25C 0.819910 no
7d_25C 7d_15C 0.139968 no
7d_25C 7d_30C 0.993103 no
7d_25C 10d_25C 0.742182 no
7d_15C 7d_30C 0.155568 no
7d_15C 10d_25C 0.341447 no
7d_30C 10d_25C 0.756114 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4563.t1
MADTAQRHPNLHLTPEEKRVFFQLFQAADTTNLGVITGEIAVPFFEKTHLSPDTLGLIWQIADKENRGLLTPSGF
GIVLRLIGHAQAGRAPSDELALQSGPLPRFDGIVVDTTASVPESGTKSPPPGANGPIRVPPLQPDDANKFVSLFE
KSDVKNGMISGEIAKQIFERARLPNEVLGRIWFLSDTKQRGALDATEFTIAMHLLTSYKSGALRGIPATLPPGLY
DAAARRGPPARVSFGARPDVPPIPAIPQQFTGPQRTTSPMNQANRSPFVGSLSAQVTGGDWLITPQEKAQFDSIF
ETVDTAKLGLITGDQAVSFFMKAQLPEETLAQIWDLADIDADGQLSREEFAVAMYLVRLQRSGKEPLPQVVPPAL
IPPNMRRQVPAPMAAPTPPPAPAPVVRTAADDLFGLDSPAPPFAQPQMPQSTGGSNSAFQTPGSPSSRASPQTAS
QTFKPFIPTSTFGQSLQPQITGASAATPRAVRSPPPPSDDLLGDNDPEESNKLTNETTELANLSNQIGSLAKEMH
TVQEKRTFAEQSITQTSQQKRDFEARLAQARSMYEQEVTNFKALEERLKSSKAETQKLQQQYALLDGSRQDLQNQ
YTQVSTALASDEQENSSLKEKIRQANAEVAQLKPALEKARSSARQQKGLVAINKKQLATVEGERDKLQGEIDSLA
NETPQYSQESATPAGSVADVVSPAASTTSQNTNPFFRRTGSSSEQARSPDVSNDQQKAFDSLFGQPFAAFPAAGP
PPTSFRSESPQVAVTSPITSAVTTPSVSPPPGSLPGAFPSGAFSEPPPASQSRQLTPNFLQFNDNQSVTSSTMVS
PPASRFGGAETSGIATPSQAASSDYGPTSGPESSDYTRAPTSTFEGTPARSPFEEEGQDLSVRFPEPSKTVQQPQ
SAATPVANESQVEDGKDLSFDELFGSKAHKRSESQQDNDFEEAFASMKPVPGAEQPNGAASARPSEFPPIQELHH
DDDEDESSDDEGAFGFEDNFTPPAPNVQKETQQDSIDAAQLAAFPVPGTSNKPPSPGVLQSPPEYETAKEDNVHL
PPQFNGLLPERGDPTVAPDAPHSVEHTTGAPVVSNETNRDSVSDAAIPPGGAKVGGPDFEAAFAGMNLAPAIEAD
DDDDDEPQGQEAKNTTDFDFSFDSPSQKQQAVSGADAQSSSSQFFAFDNNIHASAAPPVGSPNGGEPKPAALHEW
DTLFAPLDNAKPDIGEDANDAKSKQPGWALNNDTGDDLILQRLTGMGFTRDESLDALEKYDYNLDKAADHLTSRT
*
Coding >Pro_DTO377G3_2|g4563.t1
ATGGCTGATACCGCACAGCGACACCCGAATCTTCACCTCACTCCAGAGGAAAAGCGCGTATTCTTCCAGCTTTTC
CAGGCTGCCGATACCACCAATCTCGGGGTCATTACCGGTGAAATCGCCGTTCCATTCTTTGAGAAGACTCACCTA
TCCCCGGATACTCTCGGCCTGATTTGGCAAATTGCCGATAAAGAGAACAGGGGCCTCCTGACCCCATCTGGCTTC
GGGATTGTTCTGCGGTTAATTGGACATGCCCAAGCTGGCCGTGCACCTTCGGACGAGTTGGCTCTGCAATCTGGC
CCTCTGCCTCGTTTTGACGGAATTGTGGTCGACACAACGGCAAGCGTCCCGGAATCCGGAACCAAAAGCCCTCCA
CCTGGAGCCAATGGACCTATTCGTGTTCCACCCCTTCAGCCTGATGATGCCAATAAATTCGTCTCGCTGTTCGAG
AAGTCGGACGTCAAGAACGGGATGATCTCAGGCGAAATTGCAAAACAGATCTTCGAACGCGCTCGGCTCCCAAAT
GAGGTTCTGGGTCGCATCTGGTTTTTGTCTGACACTAAGCAGCGAGGTGCCTTGGATGCCACTGAGTTTACCATT
GCCATGCATCTACTGACATCATATAAATCTGGCGCCCTGCGCGGTATCCCTGCGACCCTCCCGCCTGGTCTGTAC
GATGCGGCAGCTCGCAGGGGACCTCCTGCACGGGTGTCTTTTGGGGCGAGACCCGATGTGCCCCCCATCCCGGCC
ATTCCCCAGCAATTTACTGGCCCTCAGCGAACTACAAGCCCTATGAACCAAGCCAATCGCTCCCCCTTTGTAGGC
TCTCTTTCCGCCCAGGTCACCGGTGGTGACTGGTTGATTACCCCACAAGAGAAGGCCCAGTTTGATAGCATATTC
GAGACTGTTGACACAGCCAAGTTGGGACTTATTACTGGAGACCAAGCTGTATCTTTCTTCATGAAGGCCCAGCTT
CCTGAAGAGACGCTTGCCCAAATTTGGGACCTTGCAGATATCGACGCAGACGGCCAGCTGAGCCGGGAAGAATTT
GCCGTGGCTATGTACTTGGTGAGATTGCAGCGTAGCGGCAAGGAGCCGCTGCCACAGGTGGTCCCGCCCGCGCTC
ATTCCGCCCAATATGCGCCGCCAAGTGCCCGCACCAATGGCAGCCCCCACACCTCCCCCGGCTCCCGCCCCCGTT
GTGCGGACAGCTGCTGATGATTTGTTCGGCCTCGATTCGCCCGCGCCGCCATTCGCCCAGCCTCAGATGCCACAG
TCTACCGGAGGCTCCAATAGTGCTTTCCAGACTCCAGGCTCGCCTTCCTCTAGGGCATCCCCTCAGACAGCATCG
CAAACCTTCAAGCCTTTTATTCCAACCTCTACATTTGGCCAGAGCTTGCAGCCACAGATCACCGGTGCATCGGCG
GCAACCCCGAGAGCAGTTCGCTCACCCCCGCCTCCATCGGATGATCTCCTCGGTGACAATGACCCCGAAGAATCA
AACAAGTTGACCAATGAGACTACTGAGCTGGCGAACTTGTCCAACCAAATAGGTTCTCTGGCCAAGGAAATGCAC
ACTGTGCAGGAGAAGAGGACCTTTGCTGAACAAAGCATTACACAAACCTCGCAGCAGAAGCGTGACTTCGAGGCA
CGTCTTGCGCAAGCACGGTCAATGTACGAGCAAGAGGTTACCAATTTCAAAGCACTCGAGGAGCGCCTCAAGTCA
TCCAAGGCAGAGACGCAGAAACTGCAGCAGCAATATGCCTTGCTGGATGGCAGCCGCCAGGATTTGCAAAACCAA
TACACGCAAGTTTCGACAGCCTTGGCTAGCGATGAGCAGGAGAATTCCAGCCTGAAGGAGAAGATCCGCCAGGCC
AATGCTGAAGTTGCCCAGCTCAAGCCGGCACTGGAGAAGGCGCGATCTTCTGCGCGCCAACAGAAGGGTCTTGTT
GCCATTAACAAAAAGCAATTAGCTACCGTCGAAGGCGAACGGGACAAGCTCCAGGGTGAAATTGACAGCCTGGCC
AATGAGACCCCACAGTATTCCCAAGAGTCTGCAACACCAGCCGGCAGTGTGGCCGATGTTGTAAGCCCTGCTGCC
TCTACGACAAGCCAAAACACCAACCCGTTTTTCCGTCGAACTGGTAGCTCGAGTGAACAGGCACGGTCCCCCGAT
GTGTCAAATGATCAGCAAAAGGCATTTGACAGCCTCTTCGGACAGCCATTCGCAGCTTTCCCTGCTGCCGGACCA
CCACCCACTTCGTTCCGCTCCGAGTCGCCACAGGTTGCAGTCACATCTCCTATTACCTCTGCTGTTACGACCCCA
TCAGTCTCTCCTCCCCCTGGCTCTTTGCCTGGTGCATTTCCTTCTGGGGCCTTCTCTGAGCCACCGCCTGCGAGT
CAGTCCCGACAACTGACCCCAAACTTCCTGCAGTTCAACGATAATCAGTCTGTGACGTCGTCTACTATGGTCTCG
CCTCCTGCGAGTCGATTCGGCGGCGCTGAAACCTCTGGAATCGCTACGCCTTCCCAGGCGGCTAGCAGTGATTAT
GGACCTACATCCGGGCCAGAATCTAGCGACTACACGCGTGCACCAACCTCAACTTTTGAAGGCACCCCGGCACGG
TCCCCGTTTGAGGAGGAAGGACAAGACCTCTCAGTTAGGTTCCCCGAGCCATCCAAAACCGTTCAGCAGCCCCAA
TCTGCAGCAACTCCTGTCGCCAATGAGAGCCAGGTCGAAGACGGCAAGGACCTAAGCTTTGACGAACTGTTCGGC
AGCAAGGCACACAAACGGTCTGAATCCCAGCAAGATAACGACTTCGAGGAGGCGTTTGCTTCTATGAAGCCTGTA
CCTGGAGCCGAGCAGCCAAATGGAGCTGCATCAGCACGTCCATCCGAATTCCCCCCGATTCAAGAGCTACACCAT
GACGATGACGAAGATGAGAGCTCTGATGACGAGGGTGCTTTTGGATTCGAAGATAATTTCACGCCTCCCGCACCA
AATGTCCAAAAGGAGACCCAACAGGATTCTATTGACGCCGCTCAGCTGGCTGCTTTCCCTGTCCCGGGAACGTCA
AACAAACCCCCATCTCCTGGGGTGCTGCAGAGCCCTCCAGAGTACGAGACAGCTAAAGAAGATAACGTTCATCTT
CCTCCTCAATTCAATGGCCTATTGCCCGAGCGCGGCGATCCGACTGTGGCACCGGATGCGCCTCATTCAGTGGAG
CACACCACGGGTGCGCCAGTTGTAAGCAATGAGACCAACCGTGATTCTGTCTCGGATGCTGCTATCCCACCCGGT
GGAGCGAAGGTGGGAGGACCGGACTTTGAGGCAGCATTTGCGGGAATGAATCTTGCGCCCGCGATCGAAGCGGAT
GACGATGACGACGACGAGCCACAGGGTCAGGAGGCCAAAAACACAACTGACTTTGATTTCTCTTTCGACTCCCCG
TCCCAGAAGCAGCAAGCTGTCTCCGGTGCCGATGCCCAATCCAGCTCGTCTCAGTTCTTTGCTTTCGACAACAAT
ATCCATGCATCCGCCGCCCCGCCGGTCGGATCGCCCAACGGGGGAGAACCCAAGCCGGCTGCGCTGCATGAATGG
GACACTCTCTTTGCGCCTCTTGACAACGCCAAGCCTGATATCGGCGAAGACGCGAACGATGCGAAATCCAAGCAG
CCCGGATGGGCTCTGAACAACGACACTGGCGATGACCTGATCCTTCAGCGGCTGACCGGCATGGGCTTCACACGG
GATGAGTCCTTGGATGCCTTGGAGAAGTATGACTATAACCTTGACAAGGCCGCCGACCATTTGACTTCGAGGACT
TGA
Transcript >Pro_DTO377G3_2|g4563.t1
ATGGCTGATACCGCACAGCGACACCCGAATCTTCACCTCACTCCAGAGGAAAAGCGCGTATTCTTCCAGCTTTTC
CAGGCTGCCGATACCACCAATCTCGGGGTCATTACCGGTGAAATCGCCGTTCCATTCTTTGAGAAGACTCACCTA
TCCCCGGATACTCTCGGCCTGATTTGGCAAATTGCCGATAAAGAGAACAGGGGCCTCCTGACCCCATCTGGCTTC
GGGATTGTTCTGCGGTTAATTGGACATGCCCAAGCTGGCCGTGCACCTTCGGACGAGTTGGCTCTGCAATCTGGC
CCTCTGCCTCGTTTTGACGGAATTGTGGTCGACACAACGGCAAGCGTCCCGGAATCCGGAACCAAAAGCCCTCCA
CCTGGAGCCAATGGACCTATTCGTGTTCCACCCCTTCAGCCTGATGATGCCAATAAATTCGTCTCGCTGTTCGAG
AAGTCGGACGTCAAGAACGGGATGATCTCAGGCGAAATTGCAAAACAGATCTTCGAACGCGCTCGGCTCCCAAAT
GAGGTTCTGGGTCGCATCTGGTTTTTGTCTGACACTAAGCAGCGAGGTGCCTTGGATGCCACTGAGTTTACCATT
GCCATGCATCTACTGACATCATATAAATCTGGCGCCCTGCGCGGTATCCCTGCGACCCTCCCGCCTGGTCTGTAC
GATGCGGCAGCTCGCAGGGGACCTCCTGCACGGGTGTCTTTTGGGGCGAGACCCGATGTGCCCCCCATCCCGGCC
ATTCCCCAGCAATTTACTGGCCCTCAGCGAACTACAAGCCCTATGAACCAAGCCAATCGCTCCCCCTTTGTAGGC
TCTCTTTCCGCCCAGGTCACCGGTGGTGACTGGTTGATTACCCCACAAGAGAAGGCCCAGTTTGATAGCATATTC
GAGACTGTTGACACAGCCAAGTTGGGACTTATTACTGGAGACCAAGCTGTATCTTTCTTCATGAAGGCCCAGCTT
CCTGAAGAGACGCTTGCCCAAATTTGGGACCTTGCAGATATCGACGCAGACGGCCAGCTGAGCCGGGAAGAATTT
GCCGTGGCTATGTACTTGGTGAGATTGCAGCGTAGCGGCAAGGAGCCGCTGCCACAGGTGGTCCCGCCCGCGCTC
ATTCCGCCCAATATGCGCCGCCAAGTGCCCGCACCAATGGCAGCCCCCACACCTCCCCCGGCTCCCGCCCCCGTT
GTGCGGACAGCTGCTGATGATTTGTTCGGCCTCGATTCGCCCGCGCCGCCATTCGCCCAGCCTCAGATGCCACAG
TCTACCGGAGGCTCCAATAGTGCTTTCCAGACTCCAGGCTCGCCTTCCTCTAGGGCATCCCCTCAGACAGCATCG
CAAACCTTCAAGCCTTTTATTCCAACCTCTACATTTGGCCAGAGCTTGCAGCCACAGATCACCGGTGCATCGGCG
GCAACCCCGAGAGCAGTTCGCTCACCCCCGCCTCCATCGGATGATCTCCTCGGTGACAATGACCCCGAAGAATCA
AACAAGTTGACCAATGAGACTACTGAGCTGGCGAACTTGTCCAACCAAATAGGTTCTCTGGCCAAGGAAATGCAC
ACTGTGCAGGAGAAGAGGACCTTTGCTGAACAAAGCATTACACAAACCTCGCAGCAGAAGCGTGACTTCGAGGCA
CGTCTTGCGCAAGCACGGTCAATGTACGAGCAAGAGGTTACCAATTTCAAAGCACTCGAGGAGCGCCTCAAGTCA
TCCAAGGCAGAGACGCAGAAACTGCAGCAGCAATATGCCTTGCTGGATGGCAGCCGCCAGGATTTGCAAAACCAA
TACACGCAAGTTTCGACAGCCTTGGCTAGCGATGAGCAGGAGAATTCCAGCCTGAAGGAGAAGATCCGCCAGGCC
AATGCTGAAGTTGCCCAGCTCAAGCCGGCACTGGAGAAGGCGCGATCTTCTGCGCGCCAACAGAAGGGTCTTGTT
GCCATTAACAAAAAGCAATTAGCTACCGTCGAAGGCGAACGGGACAAGCTCCAGGGTGAAATTGACAGCCTGGCC
AATGAGACCCCACAGTATTCCCAAGAGTCTGCAACACCAGCCGGCAGTGTGGCCGATGTTGTAAGCCCTGCTGCC
TCTACGACAAGCCAAAACACCAACCCGTTTTTCCGTCGAACTGGTAGCTCGAGTGAACAGGCACGGTCCCCCGAT
GTGTCAAATGATCAGCAAAAGGCATTTGACAGCCTCTTCGGACAGCCATTCGCAGCTTTCCCTGCTGCCGGACCA
CCACCCACTTCGTTCCGCTCCGAGTCGCCACAGGTTGCAGTCACATCTCCTATTACCTCTGCTGTTACGACCCCA
TCAGTCTCTCCTCCCCCTGGCTCTTTGCCTGGTGCATTTCCTTCTGGGGCCTTCTCTGAGCCACCGCCTGCGAGT
CAGTCCCGACAACTGACCCCAAACTTCCTGCAGTTCAACGATAATCAGTCTGTGACGTCGTCTACTATGGTCTCG
CCTCCTGCGAGTCGATTCGGCGGCGCTGAAACCTCTGGAATCGCTACGCCTTCCCAGGCGGCTAGCAGTGATTAT
GGACCTACATCCGGGCCAGAATCTAGCGACTACACGCGTGCACCAACCTCAACTTTTGAAGGCACCCCGGCACGG
TCCCCGTTTGAGGAGGAAGGACAAGACCTCTCAGTTAGGTTCCCCGAGCCATCCAAAACCGTTCAGCAGCCCCAA
TCTGCAGCAACTCCTGTCGCCAATGAGAGCCAGGTCGAAGACGGCAAGGACCTAAGCTTTGACGAACTGTTCGGC
AGCAAGGCACACAAACGGTCTGAATCCCAGCAAGATAACGACTTCGAGGAGGCGTTTGCTTCTATGAAGCCTGTA
CCTGGAGCCGAGCAGCCAAATGGAGCTGCATCAGCACGTCCATCCGAATTCCCCCCGATTCAAGAGCTACACCAT
GACGATGACGAAGATGAGAGCTCTGATGACGAGGGTGCTTTTGGATTCGAAGATAATTTCACGCCTCCCGCACCA
AATGTCCAAAAGGAGACCCAACAGGATTCTATTGACGCCGCTCAGCTGGCTGCTTTCCCTGTCCCGGGAACGTCA
AACAAACCCCCATCTCCTGGGGTGCTGCAGAGCCCTCCAGAGTACGAGACAGCTAAAGAAGATAACGTTCATCTT
CCTCCTCAATTCAATGGCCTATTGCCCGAGCGCGGCGATCCGACTGTGGCACCGGATGCGCCTCATTCAGTGGAG
CACACCACGGGTGCGCCAGTTGTAAGCAATGAGACCAACCGTGATTCTGTCTCGGATGCTGCTATCCCACCCGGT
GGAGCGAAGGTGGGAGGACCGGACTTTGAGGCAGCATTTGCGGGAATGAATCTTGCGCCCGCGATCGAAGCGGAT
GACGATGACGACGACGAGCCACAGGGTCAGGAGGCCAAAAACACAACTGACTTTGATTTCTCTTTCGACTCCCCG
TCCCAGAAGCAGCAAGCTGTCTCCGGTGCCGATGCCCAATCCAGCTCGTCTCAGTTCTTTGCTTTCGACAACAAT
ATCCATGCATCCGCCGCCCCGCCGGTCGGATCGCCCAACGGGGGAGAACCCAAGCCGGCTGCGCTGCATGAATGG
GACACTCTCTTTGCGCCTCTTGACAACGCCAAGCCTGATATCGGCGAAGACGCGAACGATGCGAAATCCAAGCAG
CCCGGATGGGCTCTGAACAACGACACTGGCGATGACCTGATCCTTCAGCGGCTGACCGGCATGGGCTTCACACGG
GATGAGTCCTTGGATGCCTTGGAGAAGTATGACTATAACCTTGACAAGGCCGCCGACCATTTGACTTCGAGGACT
TGA
Gene >Pro_DTO377G3_2|g4563.t1
ATGGCTGATACCGGTAAGTAATACTTAATATTCCTTGCTAGAGCCAATACGAATCGTGAGAGAGCTTCGGCGCAC
TCAAGGGAAACGCCCGCCGACCTCCGTCATCACCACCCCTCCCCTTCTTGCACTCGCACTCTATATGCGCGATCT
AGCGGAGCTGACGGAACACAATCTTTTAGCACAGCGACACCCGAATCTTCACCTCACTCCAGAGGAAAAGCGCGT
ATTCTTCCAGCTTTTCCAGGCTGCCGATACCACCAATCTCGGGGTCATTACCGGTGAAATCGCCGTTCCATTCTT
TGAGAAGACTCACCTATCCCCGGATACTCTCGGCCTGGTATGTGGATAGAATATGGGTGTTAGATCGCAATAGTG
AGAGGGATAGCTAATGAGTGGTCTTGTAGATTTGGCAAATTGCCGATAAAGAGAACAGGGGCCTCCTGACCCCAT
CTGGCTTCGGGATTGTTCTGCGGTTAATTGGACATGCCCAAGCTGGCCGTGCACCTTCGGACGAGTTGGCTCTGC
AATGTGAGTGATGTTCCCTTCAGAGAAGTGGAATCCATGCTGATCGCGCACCTATTCATAGCTGGCCCTCTGCCT
CGTTTTGACGGAATTGTGGTCGACACAACGGCAAGCGTCCCGGAATCCGGAACCAAAAGCCCTCCACCTGGAGCC
AATGGACCTATTCGTGTTCCACCCCTTCAGCCTGATGATGCCAATAAATTCGTCTCGCTGTTCGAGAAGTCGGAC
GTCAAGAACGGGATGATCTCAGGTATGTAGCTCTTCCCTGCAGATAAGGTGCCAATCTCACAAGTTCGCTGTTTG
ATCTATAGGCGAAATTGCAAAACAGATCTTCGAACGCGCTCGGCTCCCAAATGAGGTTCTGGGTCGCATCTGGTT
TTTGTCTGACACTAAGCAGCGAGGTGCCTTGGATGCCACTGAGTTTACCATTGCCATGCATCTACTGACATCATA
TAAATCTGGCGCCCTGCGCGGTATCCCTGCGACCCTCCCGCCTGGTCTGTACGATGCGGCAGCTCGCAGGGGACC
TCCTGCACGGGTGTCTTTTGGGGCGAGACCCGATGTGCCCCCCATCCCGGCCATTCCCCAGCAATTTACTGGCCC
TCAGCGAACTACAAGCCCTATGAACCAAGCCAATCGCTCCCCCTTTGTAGGCTCTCTTTCCGCCCAGGTCACCGG
TGGTGACTGGTTGATTACCCCACAAGAGAAGGCCCAGTTTGATAGCATATTCGAGACTGTTGACACAGCCAAGTT
GGGACTTATTACTGGAGACCAAGCTGTATCTTTCTTCATGAAGGCCCAGCTTCCTGAAGAGACGCTTGCCCAAAT
TTGGGACCTTGCAGATATCGACGCAGACGGCCAGCTGAGCCGGGAAGAATTTGCCGTGGCTATGTACTTGGTGAG
ATTGCAGCGTAGCGGCAAGGAGCCGCTGCCACAGGTGGTCCCGCCCGCGCTCATTCCGCCCAATATGCGCCGCCA
AGTGCCCGCACCAATGGCAGCCCCCACACCTCCCCCGGCTCCCGCCCCCGTTGTGCGGACAGCTGCTGATGATTT
GTTCGGCCTCGATTCGCCCGCGCCGCCATTCGCCCAGCCTCAGATGCCACAGTCTACCGGAGGCTCCAATAGTGC
TTTCCAGACTCCAGGCTCGCCTTCCTCTAGGGCATCCCCTCAGACAGCATCGCAAACCTTCAAGCCTTTTATTCC
AACCTCTACATTTGGCCAGAGCTTGCAGCCACAGATCACCGGTGCATCGGCGGCAACCCCGAGAGCAGTTCGCTC
ACCCCCGCCTCCATCGGATGATCTCCTCGGTGACAATGACCCCGAAGAATCAAACAAGTTGACCAATGAGACTAC
TGAGCTGGCGAACTTGTCCAACCAAATAGGTTCTCTGGCCAAGGAAATGCACACTGTGCAGGAGAAGAGGACCTT
TGCTGAACAAAGCATTACACAAACCTCGCAGCAGAAGCGTGACTTCGAGGCACGTCTTGCGCAAGCACGGTCAAT
GTACGAGCAAGAGGTTACCAATTTCAAAGCACTCGAGGAGCGCCTCAAGTCATCCAAGGCAGAGACGCAGAAACT
GCAGCAGCAATATGCCTTGCTGGATGGCAGCCGCCAGGATTTGCAAAACCAATACACGCAAGTTTCGACAGCCTT
GGCTAGCGATGAGCAGGAGAATTCCAGCCTGAAGGAGAAGATCCGCCAGGCCAATGCTGAAGTTGCCCAGCTCAA
GCCGGCACTGGAGAAGGCGCGATCTTCTGCGCGCCAACAGAAGGGTCTTGTTGCCATTAACAAAAAGCAATTAGC
TACCGTCGAAGGCGAACGGGACAAGCTCCAGGGTGAAATTGACAGCCTGGCCAATGAGACCCCACAGTATTCCCA
AGAGTCTGCAACACCAGCCGGCAGTGTGGCCGATGTTGTAAGCCCTGCTGCCTCTACGACAAGCCAAAACACCAA
CCCGTTTTTCCGTCGAACTGGTAGCTCGAGTGAACAGGCACGGTCCCCCGATGTGTCAAATGATCAGCAAAAGGC
ATTTGACAGCCTCTTCGGACAGCCATTCGCAGCTTTCCCTGCTGCCGGACCACCACCCACTTCGTTCCGCTCCGA
GTCGCCACAGGTTGCAGTCACATCTCCTATTACCTCTGCTGTTACGACCCCATCAGTCTCTCCTCCCCCTGGCTC
TTTGCCTGGTGCATTTCCTTCTGGGGCCTTCTCTGAGCCACCGCCTGCGAGTCAGTCCCGACAACTGACCCCAAA
CTTCCTGCAGTTCAACGATAATCAGTCTGTGACGTCGTCTACTATGGTCTCGCCTCCTGCGAGTCGATTCGGCGG
CGCTGAAACCTCTGGAATCGCTACGCCTTCCCAGGCGGCTAGCAGTGATTATGGACCTACATCCGGGCCAGAATC
TAGCGACTACACGCGTGCACCAACCTCAACTTTTGAAGGCACCCCGGCACGGTCCCCGTTTGAGGAGGAAGGACA
AGACCTCTCAGTTAGGTTCCCCGAGCCATCCAAAACCGTTCAGCAGCCCCAATCTGCAGCAACTCCTGTCGCCAA
TGAGAGCCAGGTCGAAGACGGCAAGGACCTAAGCTTTGACGAACTGTTCGGCAGCAAGGCACACAAACGGTCTGA
ATCCCAGCAAGATAACGACTTCGAGGAGGCGTTTGCTTCTATGAAGCCTGTACCTGGAGCCGAGCAGCCAAATGG
AGCTGCATCAGCACGTCCATCCGAATTCCCCCCGATTCAAGAGCTACACCATGACGATGACGAAGATGAGAGCTC
TGATGACGAGGGTGCTTTTGGATTCGAAGATAATTTCACGCCTCCCGCACCAAATGTCCAAAAGGAGACCCAACA
GGATTCTATTGACGCCGCTCAGCTGGCTGCTTTCCCTGTCCCGGGAACGTCAAACAAACCCCCATCTCCTGGGGT
GCTGCAGAGCCCTCCAGAGTACGAGACAGCTAAAGAAGATAACGTTCATCTTCCTCCTCAATTCAATGGCCTATT
GCCCGAGCGCGGCGATCCGACTGTGGCACCGGATGCGCCTCATTCAGTGGAGCACACCACGGGTGCGCCAGTTGT
AAGCAATGAGACCAACCGTGATTCTGTCTCGGATGCTGCTATCCCACCCGGTGGAGCGAAGGTGGGAGGACCGGA
CTTTGAGGCAGCATTTGCGGGAATGAATCTTGCGCCCGCGATCGAAGCGGATGACGATGACGACGACGAGCCACA
GGGTCAGGAGGCCAAAAACACAACTGACTTTGATTTCTCTTTCGACTCCCCGTCCCAGAAGCAGCAAGCTGTCTC
CGGTGCCGATGCCCAATCCAGCTCGTCTCAGTTCTTTGCTTTCGACAACAATATCCATGCATCCGCCGCCCCGCC
GGTCGGATCGCCCAACGGGGGAGAACCCAAGCCGGCTGCGCTGCATGAATGGGACACTCTCTTTGCGCCTCTTGA
CAACGCCAAGCCTGATATCGGCGAAGACGCGAACGATGCGAAATCCAAGCAGCCCGGATGGGCTCTGAACAACGA
CACTGGCGATGACCTGATCCTTCAGCGGCTGACCGGCATGGGCTTCACACGGGATGAGTCCTTGGATGCCTTGGA
GAAGTATGACTATAACCTTGACAAGGTAAATTGCCTTCCACATTCTGTTTTACATCATACTAACTAAAGACTAGG
CCGCCGACCATTTGACTTCGAGGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail