Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4559.t1
Gene name
Locationscaffold_09:555556..559194
Strand+
Gene length (bp)3638
Transcript length (bp)3450
Coding sequence length (bp)3450
Protein length (aa) 1150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 3.9E-47 406 582
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 2.5E-17 600 872
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 3.5E-08 306 360

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 367 386 19
2 522 539 17
3 554 576 22
4 915 937 22
5 947 964 17
6 985 1007 22
7 1022 1041 19
8 1054 1076 22
9 1086 1108 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4559.t1
MARPKVDPMDQRNAPLRSHPPGPPFPEARDEHGSRIVFIPPCGTFSESDQRGRSQEQNQEHNQSHSPFKRRDHSE
LPPIQTSLLAGVVSDSSTRPSGNSNSGPSGEQPFLSKLLDKSPFHPNKTTTSGEENKGHIQSKHDGSQESKDEEE
YYKFRASLSNSLEDTSPIEQQDESGQSDSLLSEKKDQVRLFRSSLLAGAKAQEDRRRSKRTPTSPDHPQIGPNAV
SESETHASIVSESKDCVIGVKENDDFSLPETLKPMTSFQEESEESLDCLIDELEAEDGNEPDDDATTLRAGEIRP
FPPSLLETKVDEGLNDAEVTVRRKKYGWNRMKEQKRNHFLKFISFFNGPVQWVMEVTILLAGGLQDWIDFGIICA
LLILNAAVGFAQEYQAGNIVESLKVTLALRSLVVRNGCIVEINAEDLVLGDIIHVEDGTIIPADGRLVCDKAYIQ
VDQSGITGESLAVDKHKGDPVFSSSVVKRGAGIMVVTATGDHTFVGNAAVLVNKAGNNDGHFTRVLREMARVLLI
LVLLTLLVVWISSYYRSNPIVQILEFTVAITVIGVPVGLPVVVTTTMAVGASYLAKHQAIVQKLSAIESLAGVEI
LCSDKTGTLTRNRLKLGVPYVTPGMSAEELMLTACLAATRKKGGVDAIDKVFLKGLRHYPWAKSQIASYKTLDFS
PFDPVSKKVTAYVQALDGEKVLCVKGAPMTILRTVEKETTLCEPFFKEYEDKVTEFASRGFRALGVARKRQGRPW
EILGIMPCLDPPRHDTAKTLAEAQELGLSVKMLTGDAVAIARETARRLGLGTNIYNAERLGVTGAGSMSGSEVND
FVEAADGFAEVYPQHKYSVVEILQRRGYLVAMTGDGVNDAASLKKADTGIAVEGASDAARSAADIVFLAPGLSAI
IEAIKIARQIFHRMYSYVVFRIALSIHLEIFLGLWMVIKNETLDLRLIVLLAIFADIATLAIAYDNATYSQSPVK
WNQPRLWGESIVLGFILAVGTWVTLGTILLQGEDGGVIEGWGSRDEVLFLEIALTQSWLIMITRISGSKSRSFWA
NCPSFYLIVAVGAVDLTATLMAAYGAFGQATSWLTVLRVWILSSGVTCVNTLAYILMHNSQRFDNLMHGKSPRKK
YGERSWEDFGLNMQRMAKQHEKTT*
Coding >Pro_DTO377G3_2|g4559.t1
ATGGCCAGACCCAAGGTTGACCCGATGGATCAGCGGAACGCACCTCTCAGGAGTCATCCGCCCGGACCTCCCTTT
CCTGAAGCCAGGGACGAGCATGGTTCTCGTATTGTTTTTATTCCGCCGTGTGGAACTTTCTCTGAGAGCGACCAA
CGGGGCCGTTCCCAGGAACAGAACCAGGAGCATAACCAATCTCACAGTCCTTTCAAGCGACGAGACCATTCTGAA
CTGCCTCCCATTCAGACCAGTCTCCTGGCAGGGGTGGTTTCAGATTCCTCGACTCGCCCTTCAGGTAATTCGAAT
TCAGGCCCTAGTGGAGAGCAGCCTTTCCTGTCCAAGCTCCTCGACAAATCTCCATTCCATCCGAACAAGACCACC
ACTTCCGGAGAGGAAAATAAAGGCCATATTCAGTCGAAGCACGATGGTTCCCAAGAATCCAAGGATGAAGAGGAA
TATTACAAGTTTCGTGCCAGCTTGAGCAACAGCTTGGAGGACACTTCTCCTATTGAACAGCAAGACGAAAGTGGA
CAGAGCGACAGCTTGCTATCCGAGAAGAAAGATCAGGTTAGACTGTTCCGTTCCAGTCTACTTGCTGGTGCCAAG
GCCCAGGAAGATCGACGCCGTTCCAAGCGCACTCCGACATCCCCTGACCATCCTCAAATTGGTCCTAATGCGGTT
TCCGAATCTGAAACGCATGCTTCCATCGTTAGCGAGAGCAAAGACTGCGTCATTGGCGTTAAAGAGAACGACGAC
TTTTCTCTCCCGGAGACATTGAAACCTATGACCTCTTTCCAGGAAGAGAGCGAAGAATCTCTGGATTGCCTCATT
GATGAACTGGAGGCCGAAGATGGCAATGAACCTGACGATGATGCAACCACTCTCCGAGCTGGGGAAATTCGCCCA
TTCCCTCCTTCCCTGCTGGAAACCAAGGTCGACGAGGGCCTCAACGACGCAGAGGTGACCGTTCGGCGCAAGAAG
TATGGCTGGAATCGCATGAAGGAGCAGAAACGGAACCATTTCCTCAAATTCATCTCCTTCTTCAATGGCCCAGTC
CAGTGGGTCATGGAGGTTACCATTCTTCTAGCTGGCGGCCTGCAAGATTGGATAGATTTCGGAATCATTTGTGCC
CTGCTCATACTAAATGCCGCGGTCGGATTTGCCCAGGAATACCAAGCGGGGAACATTGTCGAGAGCCTCAAGGTA
ACTCTTGCCCTGAGATCTCTGGTCGTTCGTAACGGTTGCATCGTGGAGATAAATGCCGAAGACCTCGTTCTTGGT
GATATCATTCACGTGGAAGATGGCACCATCATCCCGGCAGATGGCAGACTGGTATGCGACAAGGCCTATATTCAG
GTTGATCAGTCTGGAATCACGGGGGAATCTCTCGCTGTGGATAAACACAAAGGTGACCCTGTCTTTTCTTCTTCG
GTAGTCAAACGCGGGGCTGGAATCATGGTTGTGACGGCCACTGGTGATCACACCTTTGTCGGAAATGCAGCGGTC
CTGGTTAACAAGGCTGGCAATAACGATGGCCACTTTACTCGGGTACTGCGCGAAATGGCCCGTGTTCTTCTGATT
CTGGTGCTTCTCACCCTGCTGGTTGTGTGGATCAGCAGTTATTATCGCTCAAATCCGATTGTCCAGATACTTGAG
TTCACGGTCGCAATCACCGTGATCGGAGTCCCCGTCGGTCTTCCCGTGGTTGTCACCACGACAATGGCCGTTGGT
GCGTCTTACCTGGCCAAGCATCAGGCTATTGTGCAAAAGCTCTCAGCTATCGAGTCATTGGCTGGAGTGGAGATC
CTCTGTTCAGACAAAACGGGAACACTCACTCGTAACAGATTGAAATTGGGAGTTCCATATGTAACCCCCGGAATG
AGTGCGGAAGAGCTTATGCTGACTGCGTGTCTTGCGGCAACTCGGAAAAAGGGCGGCGTCGATGCCATCGACAAG
GTATTCCTCAAAGGTCTTCGCCACTACCCGTGGGCCAAATCTCAGATCGCCTCGTACAAGACTCTTGACTTTTCT
CCATTTGATCCGGTGTCAAAGAAGGTCACTGCCTATGTGCAAGCTCTGGATGGTGAGAAGGTCCTTTGTGTCAAG
GGTGCTCCTATGACCATCCTGAGAACAGTGGAGAAGGAAACCACATTGTGCGAGCCGTTCTTCAAGGAATATGAG
GATAAGGTCACCGAGTTTGCTAGTCGAGGATTTCGTGCACTCGGAGTTGCCCGCAAGCGTCAAGGACGGCCATGG
GAGATTCTGGGAATCATGCCATGCCTGGATCCCCCACGCCATGACACTGCTAAGACACTTGCCGAAGCTCAAGAA
CTGGGACTCTCTGTCAAGATGCTCACTGGGGATGCGGTGGCCATTGCACGTGAAACGGCACGTAGACTCGGTCTC
GGAACCAACATTTACAATGCCGAACGACTTGGTGTCACTGGCGCCGGCTCCATGTCCGGCTCGGAAGTGAATGAC
TTTGTTGAGGCCGCTGACGGCTTCGCAGAAGTCTACCCCCAGCACAAGTACAGTGTAGTTGAGATTCTCCAGCGA
CGCGGCTATCTGGTGGCGATGACTGGCGATGGTGTGAACGATGCTGCTTCGTTGAAAAAGGCGGACACGGGAATT
GCGGTAGAGGGCGCGTCGGATGCGGCCCGCTCCGCTGCTGACATTGTCTTCTTGGCACCCGGTCTGTCCGCAATC
ATCGAGGCGATCAAGATCGCTCGGCAGATCTTCCACCGCATGTACTCATATGTGGTGTTCCGGATCGCCCTGTCC
ATTCACTTGGAGATCTTCCTCGGGCTCTGGATGGTGATCAAGAATGAGACCCTCGACCTCCGCCTGATTGTTCTT
CTCGCTATCTTTGCCGACATTGCGACCTTGGCCATTGCATATGACAACGCTACTTATTCGCAGTCCCCTGTCAAA
TGGAACCAGCCAAGGCTCTGGGGTGAGTCAATTGTCCTGGGCTTCATTCTCGCAGTCGGTACCTGGGTGACTCTG
GGCACTATTCTGTTGCAAGGCGAGGACGGCGGTGTTATCGAAGGCTGGGGTTCACGAGATGAGGTCTTGTTCCTG
GAGATTGCTCTGACTCAGAGCTGGTTGATTATGATAACTCGCATCAGTGGATCTAAATCGAGATCGTTCTGGGCA
AACTGCCCATCATTTTACCTTATCGTCGCCGTGGGTGCTGTCGATCTGACCGCAACCTTGATGGCCGCATATGGT
GCCTTCGGTCAAGCCACATCCTGGTTGACCGTCCTCCGTGTGTGGATTCTCTCCTCTGGTGTGACATGTGTAAAC
ACACTGGCTTACATCTTGATGCATAACTCGCAAAGGTTCGACAACCTTATGCATGGGAAAAGTCCTCGAAAGAAG
TACGGAGAGCGCTCGTGGGAAGACTTCGGCCTTAACATGCAGCGAATGGCCAAACAACATGAGAAGACCACTTAG
Transcript >Pro_DTO377G3_2|g4559.t1
ATGGCCAGACCCAAGGTTGACCCGATGGATCAGCGGAACGCACCTCTCAGGAGTCATCCGCCCGGACCTCCCTTT
CCTGAAGCCAGGGACGAGCATGGTTCTCGTATTGTTTTTATTCCGCCGTGTGGAACTTTCTCTGAGAGCGACCAA
CGGGGCCGTTCCCAGGAACAGAACCAGGAGCATAACCAATCTCACAGTCCTTTCAAGCGACGAGACCATTCTGAA
CTGCCTCCCATTCAGACCAGTCTCCTGGCAGGGGTGGTTTCAGATTCCTCGACTCGCCCTTCAGGTAATTCGAAT
TCAGGCCCTAGTGGAGAGCAGCCTTTCCTGTCCAAGCTCCTCGACAAATCTCCATTCCATCCGAACAAGACCACC
ACTTCCGGAGAGGAAAATAAAGGCCATATTCAGTCGAAGCACGATGGTTCCCAAGAATCCAAGGATGAAGAGGAA
TATTACAAGTTTCGTGCCAGCTTGAGCAACAGCTTGGAGGACACTTCTCCTATTGAACAGCAAGACGAAAGTGGA
CAGAGCGACAGCTTGCTATCCGAGAAGAAAGATCAGGTTAGACTGTTCCGTTCCAGTCTACTTGCTGGTGCCAAG
GCCCAGGAAGATCGACGCCGTTCCAAGCGCACTCCGACATCCCCTGACCATCCTCAAATTGGTCCTAATGCGGTT
TCCGAATCTGAAACGCATGCTTCCATCGTTAGCGAGAGCAAAGACTGCGTCATTGGCGTTAAAGAGAACGACGAC
TTTTCTCTCCCGGAGACATTGAAACCTATGACCTCTTTCCAGGAAGAGAGCGAAGAATCTCTGGATTGCCTCATT
GATGAACTGGAGGCCGAAGATGGCAATGAACCTGACGATGATGCAACCACTCTCCGAGCTGGGGAAATTCGCCCA
TTCCCTCCTTCCCTGCTGGAAACCAAGGTCGACGAGGGCCTCAACGACGCAGAGGTGACCGTTCGGCGCAAGAAG
TATGGCTGGAATCGCATGAAGGAGCAGAAACGGAACCATTTCCTCAAATTCATCTCCTTCTTCAATGGCCCAGTC
CAGTGGGTCATGGAGGTTACCATTCTTCTAGCTGGCGGCCTGCAAGATTGGATAGATTTCGGAATCATTTGTGCC
CTGCTCATACTAAATGCCGCGGTCGGATTTGCCCAGGAATACCAAGCGGGGAACATTGTCGAGAGCCTCAAGGTA
ACTCTTGCCCTGAGATCTCTGGTCGTTCGTAACGGTTGCATCGTGGAGATAAATGCCGAAGACCTCGTTCTTGGT
GATATCATTCACGTGGAAGATGGCACCATCATCCCGGCAGATGGCAGACTGGTATGCGACAAGGCCTATATTCAG
GTTGATCAGTCTGGAATCACGGGGGAATCTCTCGCTGTGGATAAACACAAAGGTGACCCTGTCTTTTCTTCTTCG
GTAGTCAAACGCGGGGCTGGAATCATGGTTGTGACGGCCACTGGTGATCACACCTTTGTCGGAAATGCAGCGGTC
CTGGTTAACAAGGCTGGCAATAACGATGGCCACTTTACTCGGGTACTGCGCGAAATGGCCCGTGTTCTTCTGATT
CTGGTGCTTCTCACCCTGCTGGTTGTGTGGATCAGCAGTTATTATCGCTCAAATCCGATTGTCCAGATACTTGAG
TTCACGGTCGCAATCACCGTGATCGGAGTCCCCGTCGGTCTTCCCGTGGTTGTCACCACGACAATGGCCGTTGGT
GCGTCTTACCTGGCCAAGCATCAGGCTATTGTGCAAAAGCTCTCAGCTATCGAGTCATTGGCTGGAGTGGAGATC
CTCTGTTCAGACAAAACGGGAACACTCACTCGTAACAGATTGAAATTGGGAGTTCCATATGTAACCCCCGGAATG
AGTGCGGAAGAGCTTATGCTGACTGCGTGTCTTGCGGCAACTCGGAAAAAGGGCGGCGTCGATGCCATCGACAAG
GTATTCCTCAAAGGTCTTCGCCACTACCCGTGGGCCAAATCTCAGATCGCCTCGTACAAGACTCTTGACTTTTCT
CCATTTGATCCGGTGTCAAAGAAGGTCACTGCCTATGTGCAAGCTCTGGATGGTGAGAAGGTCCTTTGTGTCAAG
GGTGCTCCTATGACCATCCTGAGAACAGTGGAGAAGGAAACCACATTGTGCGAGCCGTTCTTCAAGGAATATGAG
GATAAGGTCACCGAGTTTGCTAGTCGAGGATTTCGTGCACTCGGAGTTGCCCGCAAGCGTCAAGGACGGCCATGG
GAGATTCTGGGAATCATGCCATGCCTGGATCCCCCACGCCATGACACTGCTAAGACACTTGCCGAAGCTCAAGAA
CTGGGACTCTCTGTCAAGATGCTCACTGGGGATGCGGTGGCCATTGCACGTGAAACGGCACGTAGACTCGGTCTC
GGAACCAACATTTACAATGCCGAACGACTTGGTGTCACTGGCGCCGGCTCCATGTCCGGCTCGGAAGTGAATGAC
TTTGTTGAGGCCGCTGACGGCTTCGCAGAAGTCTACCCCCAGCACAAGTACAGTGTAGTTGAGATTCTCCAGCGA
CGCGGCTATCTGGTGGCGATGACTGGCGATGGTGTGAACGATGCTGCTTCGTTGAAAAAGGCGGACACGGGAATT
GCGGTAGAGGGCGCGTCGGATGCGGCCCGCTCCGCTGCTGACATTGTCTTCTTGGCACCCGGTCTGTCCGCAATC
ATCGAGGCGATCAAGATCGCTCGGCAGATCTTCCACCGCATGTACTCATATGTGGTGTTCCGGATCGCCCTGTCC
ATTCACTTGGAGATCTTCCTCGGGCTCTGGATGGTGATCAAGAATGAGACCCTCGACCTCCGCCTGATTGTTCTT
CTCGCTATCTTTGCCGACATTGCGACCTTGGCCATTGCATATGACAACGCTACTTATTCGCAGTCCCCTGTCAAA
TGGAACCAGCCAAGGCTCTGGGGTGAGTCAATTGTCCTGGGCTTCATTCTCGCAGTCGGTACCTGGGTGACTCTG
GGCACTATTCTGTTGCAAGGCGAGGACGGCGGTGTTATCGAAGGCTGGGGTTCACGAGATGAGGTCTTGTTCCTG
GAGATTGCTCTGACTCAGAGCTGGTTGATTATGATAACTCGCATCAGTGGATCTAAATCGAGATCGTTCTGGGCA
AACTGCCCATCATTTTACCTTATCGTCGCCGTGGGTGCTGTCGATCTGACCGCAACCTTGATGGCCGCATATGGT
GCCTTCGGTCAAGCCACATCCTGGTTGACCGTCCTCCGTGTGTGGATTCTCTCCTCTGGTGTGACATGTGTAAAC
ACACTGGCTTACATCTTGATGCATAACTCGCAAAGGTTCGACAACCTTATGCATGGGAAAAGTCCTCGAAAGAAG
TACGGAGAGCGCTCGTGGGAAGACTTCGGCCTTAACATGCAGCGAATGGCCAAACAACATGAGAAGACCACTTAG
Gene >Pro_DTO377G3_2|g4559.t1
ATGGCCAGACCCAAGGTTGACCCGATGGATCAGCGGAACGCACCTCTCAGGAGTCATCCGCCCGGACCTCCCTTT
CCTGAAGCCAGGGACGAGCATGGTTCTCGTATTGTTTTTATTCCGCCGTGTGGAACTTTCTCTGAGAGCGACCAA
CGGGGCCGTTCCCAGGAACAGAACCAGGAGCATAACCAATCTCACAGTCCTTTCAAGCGACGAGACCATTCTGAA
CTGCCTCCCATTCAGACCAGTCTCCTGGCAGGGGTGGTTTCAGATTCCTCGACTCGCCCTTCAGGTAATTCGAAT
TCAGGCCCTAGTGGAGAGCAGCCTTTCCTGTCCAAGCTCCTCGACAAATCTCCATTCCATCCGAACAAGACCACC
ACTTCCGGAGAGGAAAATAAAGGCCATATTCAGTCGAAGCACGATGGTTCCCAAGAATCCAAGGATGAAGAGGAA
TATTACAAGTTTCGTGCCAGCTTGAGCAACAGCTTGGAGGACACTTCTCCTATTGAACAGCAAGACGAAAGTGGA
CAGAGCGACAGCTTGCTATCCGAGAAGAAAGATCAGGTTAGACTGTTCCGTTCCAGTCTACTTGCTGGTGCCAAG
GCCCAGGAAGATCGACGCCGTTCCAAGCGCACTCCGACATCCCCTGACCATCCTCAAATTGGTCCTAATGCGGTT
TCCGAATCTGAAACGCATGCTTCCATCGTTAGCGAGAGCAAAGACTGCGTCATTGGCGTTAAAGAGAACGACGAC
TTTTCTCTCCCGGAGACATTGAAACCTATGACCTCTTTCCAGGAAGAGAGCGAAGAATCTCTGGATTGCCTCATT
GATGAACTGGAGGCCGAAGATGGCAATGAACCTGACGATGATGCAACCACTCTCCGAGCTGGGGAAATTCGCCCA
TTCCCTCCTTCCCTGCTGGAAACCAAGGTCGACGAGGGCCTCAACGACGCAGAGGTGACCGTTCGGCGCAAGAAG
TATGGCTGGAATCGCATGAAGGAGCAGAAACGGAACCATTTCCTCAAATTCATCTCCTTCTTCAATGGCCCAGTC
CAGTGGGTCATGGAGGTAAGCAAGATCATCATTGACCACTATAGCGTAGTTGGAAAAAATATATGCTCACACTGT
TTTCTCAATTACAGGTTACCATTCTTCTAGCTGGCGGCCTGCAAGATTGGATAGATTTCGGAATCATTTGTGCCC
TGCTCATACTAAATGCCGCGGTCGGATTTGCCCAGGAATACCAAGCGGGGAACATTGTCGAGAGCCTCAAGGTAA
CTCTTGCCCTGAGATCTCTGGTCGTTCGTAACGGTTGCATCGTGGAGATAAATGCCGAAGACCTCGTTCTTGGTG
ATATCATTCACGTGGAAGATGTGAGTTCATGAGGAAATAGGAAAAAAAGACTCAGGCTAATATCCCATTCAGGGC
ACCATCATCCCGGCAGATGGCAGACTGGTATGCGACAAGGCCTATATTCAGGTTGATCAGTCTGGAATCACGGGG
GAATCTCTCGCTGTGGATAAACACAAAGGTGACCCTGTCTTTTCTTCTTCGGTAGTCAAACGCGGGGCTGGAATC
ATGGTTGTGACGGCCACTGGTGATCACACCTTTGTCGGAAATGCAGCGGTCCTGGTTAACAAGGCTGGCAATAAC
GATGGCCACTTTACTCGGGTACTGCGCGAAATGGCCCGTGTTCTTCTGATTCTGGTGCTTCTCACCCTGCTGGTT
GTGTGGATCAGCAGTTATTATCGCTCAAATCCGATTGTCCAGATACTTGAGTTCACGGTCGCAATCACCGTGATC
GGAGTCCCCGTCGGTCTTCCCGTGGTTGTCACCACGACAATGGCCGTTGGTGCGTCTTACCTGGCCAAGCATCAG
GCTATTGTGCAAAAGCTCTCAGCTATCGAGTCATTGGCTGGAGTGGAGATCCTCTGTTCAGACAAAACGGGAACA
CTCACTCGTAACAGATTGAAATTGGGAGTTCCATATGTAACCCCCGGAATGAGTGCGGAAGAGCTTATGCTGACT
GCGTGTCTTGCGGCAACTCGGAAAAAGGGCGGCGTCGATGCCATCGACAAGGTATTCCTCAAAGGTCTTCGCCAC
TACCCGTGGGCCAAATCTCAGATCGCCTCGTACAAGACTCTTGACTTTTCTCCATTTGATCCGGTGTCAAAGAAG
GTCACTGCCTATGTGCAAGCTCTGGATGGTGAGAAGGTCCTTTGTGTCAAGGGTGCTCCTATGACCATCCTGAGA
ACAGTGGAGAAGGAAACCACATTGTGCGAGCCGTTCTTCAAGGAATATGAGGATAAGGTCACCGAGTTTGCTAGT
CGAGGATTTCGTGCACTCGGAGTTGCCCGCAAGCGTCAAGGACGGCCATGGGAGATTCTGGGAATCATGCCATGC
CTGGATCCCCCACGCCATGACACTGCTAAGACACTTGCCGAAGCTCAAGAACTGGGACTCTCTGTCAAGATGCTC
ACTGGGGATGCGGTGGCCATTGCACGTGAAACGGCACGTAGACTCGGTCTCGGAACCAACATTTACAATGCCGAA
CGACTTGGTGTCACTGGCGCCGGCTCCATGTCCGGCTCGGAAGTGAATGACTTTGTTGAGGCCGCTGACGGCTTC
GCAGAAGTCTACCCCCAGCACAAGTACAGTGTAGTTGAGATTCTCCAGCGACGCGGCTATCTGGTGGCGATGACT
GGCGATGGTGTGAACGATGCTGCTTCGTTGAAAAAGGCGGACACGGGAATTGCGGTAGAGGGCGCGTCGGATGCG
GCCCGCTCCGCTGCTGACATTGTCTTCTTGGCACCCGGTCTGTCCGCAATCATCGAGGCGATCAAGATCGCTCGG
CAGATCTTCCACCGCATGTACTCATATGTGGTGTTCCGGATCGCCCTGTCCATTCACTTGGAGATCTTCCTCGGG
CTCTGGATGGTGATCAAGAATGAGACCCTCGACCTCCGCCTGATTGTTCTTCTCGCTATCTTTGCCGACATTGCG
ACCTTGGCCATTGCATATGACAACGCTACTTATTCGCAGTCCCCTGTCAAATGGAACCAGCCAAGGCTCTGGGGT
GAGTCAATTGTCCTGGGCTTCATTCTCGCAGTCGGTACCTGGGTGACTCTGGGCACTATTCTGTTGCAAGGCGAG
GACGGCGGTGTTATCGAAGGCTGGGGTTCACGAGATGAGGTCTTGTTCCTGGAGATTGCTCTGACTCAGAGCTGG
TTGATTATGATAACTCGCATCAGTGGATCTAAATCGAGATCGTTCTGGGCAAACTGCCCATCATTTTACCTTATC
GTCGCCGTGGGTGCTGTCGATCTGACCGCAACCTTGATGGCCGCATATGGTGCCTTCGGTCAAGCCACATCCTGG
TTGACCGTCCTCCGTGTGTGGATTCTCTCCTCTGGTGTGACATGTGTAAACACACTGGCTTACATCTTGATGCAT
AACTCGCAAAGGTTCGACAACCTTATGCATGGGAAAAGTCCTCGAAAGAAGTACGGAGAGCGCTCGTGGGAAGAC
TTCGGTAAGTTCGCACAGACTCAATGTCTCCTCGCAGAATTTTAACGGGAAACTAACCAATCATAGGCCTTAACA
TGCAGCGAATGGCCAAACAACATGAGAAGACCACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail