Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4557.t1
Gene name
Locationscaffold_09:549822..551548
Strand+
Gene length (bp)1726
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14630 ORC5_C Origin recognition complex (ORC) subunit 5 C-terminus 6.0E-87 182 524
PF13191 AAA_16 AAA ATPase domain 8.2E-15 13 162

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0000808 origin recognition complex Yes
GO:0006260 DNA replication Yes
GO:0043227 membrane-bounded organelle No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005575 cellular_component No
GO:0044260 cellular macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043229 intracellular organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 32.63 18.62 46.64
5d_25C Five days - 25 degrees Celsius 29.69 16.67 42.71
7d_25C Seven days - 25 degrees Celsius 31.47 17.84 45.10
10d_25C Ten days - 25 degrees Celsius 30.03 16.86 43.21
7d_15C Seven days - 15 degrees Celsius 23.61 12.59 34.63
7d_30C Seven days - 30 degrees Celsius 29.13 16.32 41.95

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.772701 no
3d_25C 7d_25C 0.920353 no
3d_25C 7d_15C 0.207398 no
3d_25C 7d_30C 0.717396 no
3d_25C 10d_25C 0.807634 no
5d_25C 7d_25C 0.869193 no
5d_25C 7d_15C 0.420565 no
5d_25C 7d_30C 0.963122 no
5d_25C 10d_25C 0.977493 no
7d_25C 7d_15C 0.275712 no
7d_25C 7d_30C 0.821115 no
7d_25C 10d_25C 0.898222 no
7d_15C 7d_30C 0.471864 no
7d_15C 10d_25C 0.396456 no
7d_30C 10d_25C 0.936044 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4557.t1
MLPKEVASSLSTQWPCRNVQMRQLASLLNPHVPSPPTLVVHGISATCKSTILRAVLATLEVPHAIVRSSECITGR
HLLTKILWNTLEALGQKEEWETSGKGRCEHVSGLAVLLEECLAARPVQTLGKFVLVLDEIDRQREAPHTLLSALA
RLGDIIPSLCVVLVLSSTPRPLFLQSAAVPHVSFPPYTRKEAIHIILSSDAPVVDGLPDETSSRVYPYFVSTVYD
SLVGPTAGSIPDFRSICERLWPRFVAPVVNGETPPGGNSEWDFSRLLVKNRVIFRHQGESALVHHIVPDETPAGE
KRTTLAKTAMPSALPSLPYFSTLILTSAYLASHTPQRLDTIFFSKFSSSSLSARNKRAHHRRRLKVLSQAQAEER
QAANDDPSTPNKKGKRTKTRITKSTLSSAFATSSATTSAVGGGAGIAGPSTILTARSFPLERLLAIYHAIDPNPP
ATPLRVSAVADRIYAELATLRRLRLVVPAASHNAMATSSGNTTADAGDKWCVNVSGDWVGELAKGIGVEVGEWLA
GGLD*
Coding >Pro_DTO377G3_2|g4557.t1
ATGCTACCAAAAGAGGTTGCCAGCTCATTGAGCACACAATGGCCATGTCGCAATGTCCAGATGCGGCAGCTAGCC
AGTCTGTTGAATCCTCACGTTCCTAGCCCTCCAACCTTGGTTGTCCATGGTATTTCTGCGACCTGCAAATCGACT
ATCCTCCGGGCCGTCCTTGCTACCCTCGAAGTGCCACACGCCATTGTCAGAAGTTCGGAATGTATTACGGGACGG
CATCTCCTGACGAAAATACTATGGAATACACTGGAGGCACTGGGCCAGAAGGAAGAATGGGAGACCTCCGGCAAA
GGAAGATGCGAGCACGTCAGTGGCCTTGCAGTCTTACTTGAGGAGTGCCTGGCAGCGAGGCCCGTTCAAACGCTA
GGCAAATTCGTGCTGGTGCTGGATGAGATTGACAGGCAAAGAGAGGCACCGCATACTTTGCTCTCGGCGCTGGCG
CGGCTAGGCGATATCATTCCATCTCTTTGTGTTGTTCTGGTCCTCAGCTCGACCCCACGGCCATTATTCCTCCAA
AGTGCGGCTGTTCCGCACGTCAGCTTCCCTCCCTATACCCGCAAGGAGGCTATCCACATTATTCTCAGTTCGGAC
GCGCCGGTCGTGGATGGGTTGCCCGATGAAACCTCCTCGCGGGTATACCCGTACTTTGTATCTACAGTCTACGAC
TCATTGGTGGGACCAACAGCAGGCTCTATACCGGATTTCCGGTCCATATGTGAAAGATTGTGGCCTCGGTTTGTT
GCGCCTGTAGTGAATGGCGAAACACCCCCGGGCGGGAACAGTGAGTGGGATTTCTCGCGGTTGCTTGTCAAAAAC
AGAGTCATCTTTCGACATCAGGGCGAGTCTGCGCTGGTGCACCACATTGTTCCCGATGAGACTCCTGCTGGCGAG
AAACGGACCACGCTGGCAAAAACCGCTATGCCTTCGGCCCTCCCTTCTCTGCCATATTTCTCGACCTTGATCCTC
ACATCCGCATATCTGGCCTCGCACACGCCTCAACGACTAGATACAATCTTCTTCTCTAAATTCTCCTCTTCATCC
CTTTCAGCCCGGAACAAGCGTGCCCACCACCGTCGACGTTTGAAAGTCCTCTCCCAAGCCCAGGCCGAAGAGAGA
CAAGCCGCAAACGATGACCCTTCAACCCCCAACAAGAAAGGAAAGCGAACTAAAACTCGCATTACAAAATCAACA
CTATCATCCGCCTTTGCGACCTCCTCGGCCACCACATCAGCTGTCGGCGGTGGCGCAGGCATCGCCGGCCCGTCC
ACCATCCTTACAGCCCGTTCTTTCCCCCTAGAACGTCTCCTGGCCATCTACCATGCGATCGACCCAAACCCCCCA
GCAACACCACTTCGAGTTTCAGCCGTTGCAGACCGTATCTACGCCGAACTGGCAACCCTGCGACGCCTGCGGCTC
GTTGTCCCCGCTGCTAGCCACAATGCCATGGCGACTAGTAGTGGGAATACCACTGCCGATGCGGGAGATAAGTGG
TGTGTCAACGTCTCTGGCGACTGGGTCGGTGAGCTGGCTAAGGGTATTGGTGTCGAGGTTGGTGAGTGGTTGGCT
GGCGGTCTGGACTGA
Transcript >Pro_DTO377G3_2|g4557.t1
ATGCTACCAAAAGAGGTTGCCAGCTCATTGAGCACACAATGGCCATGTCGCAATGTCCAGATGCGGCAGCTAGCC
AGTCTGTTGAATCCTCACGTTCCTAGCCCTCCAACCTTGGTTGTCCATGGTATTTCTGCGACCTGCAAATCGACT
ATCCTCCGGGCCGTCCTTGCTACCCTCGAAGTGCCACACGCCATTGTCAGAAGTTCGGAATGTATTACGGGACGG
CATCTCCTGACGAAAATACTATGGAATACACTGGAGGCACTGGGCCAGAAGGAAGAATGGGAGACCTCCGGCAAA
GGAAGATGCGAGCACGTCAGTGGCCTTGCAGTCTTACTTGAGGAGTGCCTGGCAGCGAGGCCCGTTCAAACGCTA
GGCAAATTCGTGCTGGTGCTGGATGAGATTGACAGGCAAAGAGAGGCACCGCATACTTTGCTCTCGGCGCTGGCG
CGGCTAGGCGATATCATTCCATCTCTTTGTGTTGTTCTGGTCCTCAGCTCGACCCCACGGCCATTATTCCTCCAA
AGTGCGGCTGTTCCGCACGTCAGCTTCCCTCCCTATACCCGCAAGGAGGCTATCCACATTATTCTCAGTTCGGAC
GCGCCGGTCGTGGATGGGTTGCCCGATGAAACCTCCTCGCGGGTATACCCGTACTTTGTATCTACAGTCTACGAC
TCATTGGTGGGACCAACAGCAGGCTCTATACCGGATTTCCGGTCCATATGTGAAAGATTGTGGCCTCGGTTTGTT
GCGCCTGTAGTGAATGGCGAAACACCCCCGGGCGGGAACAGTGAGTGGGATTTCTCGCGGTTGCTTGTCAAAAAC
AGAGTCATCTTTCGACATCAGGGCGAGTCTGCGCTGGTGCACCACATTGTTCCCGATGAGACTCCTGCTGGCGAG
AAACGGACCACGCTGGCAAAAACCGCTATGCCTTCGGCCCTCCCTTCTCTGCCATATTTCTCGACCTTGATCCTC
ACATCCGCATATCTGGCCTCGCACACGCCTCAACGACTAGATACAATCTTCTTCTCTAAATTCTCCTCTTCATCC
CTTTCAGCCCGGAACAAGCGTGCCCACCACCGTCGACGTTTGAAAGTCCTCTCCCAAGCCCAGGCCGAAGAGAGA
CAAGCCGCAAACGATGACCCTTCAACCCCCAACAAGAAAGGAAAGCGAACTAAAACTCGCATTACAAAATCAACA
CTATCATCCGCCTTTGCGACCTCCTCGGCCACCACATCAGCTGTCGGCGGTGGCGCAGGCATCGCCGGCCCGTCC
ACCATCCTTACAGCCCGTTCTTTCCCCCTAGAACGTCTCCTGGCCATCTACCATGCGATCGACCCAAACCCCCCA
GCAACACCACTTCGAGTTTCAGCCGTTGCAGACCGTATCTACGCCGAACTGGCAACCCTGCGACGCCTGCGGCTC
GTTGTCCCCGCTGCTAGCCACAATGCCATGGCGACTAGTAGTGGGAATACCACTGCCGATGCGGGAGATAAGTGG
TGTGTCAACGTCTCTGGCGACTGGGTCGGTGAGCTGGCTAAGGGTATTGGTGTCGAGGTTGGTGAGTGGTTGGCT
GGCGGTCTGGACTGA
Gene >Pro_DTO377G3_2|g4557.t1
ATGCTACCAAAAGAGGTTGCCAGCTCATTGAGCACACAATGGCCATGTCGCAATGTCCAGATGCGGCAGCTAGCC
AGTCTGTTGAATGTGAGTTTACTATGCATTCCTTCCATTCGCCAATCACCCTCGGAGAAAGTGACTGACCCTCAA
TATTTGAATAGCCTCACGTTCCTAGCCCTCCAACCTTGGTTGTCCATGGTATTTCTGCGACCTGCAAATCGACTA
TCCTCCGGGCCGTCCTTGCTACCCTCGAAGTGCCACACGCCATTGTCAGAAGTTCGGAATGTATTACGGGACGGC
ATCTCCTGACGAAAATACTATGGAATACACTGGAGGCACTGGGCCAGAAGGAAGAATGGGAGACCTCCGGCAAAG
GAAGATGCGAGCACGTCAGTGGCCTTGCAGTCTTACTTGAGGAGTGCCTGGCAGCGAGGCCCGTTCAAACGCTAG
GCAAATTCGTGCTGGTGCTGGATGAGATTGACAGGCAAAGAGAGGCACCGCATACTTTGCTCTCGGCGCTGGCGC
GGCTAGGCGATATCGTGAGTCGCCGCTTTGGACGACTTTTGCAAGTGTAAAATGTTGCTAACCCGATAATTTGTA
GATTCCATCTCTTTGTGTTGTTCTGGTCCTCAGCTCGACCCCACGGCCATTATTCCTCCAAAGTGCGGCTGTTCC
GCACGTCAGCTTCCCTCCCTATACCCGCAAGGAGGCTATCCACATTATTCTCAGTTCGGACGCGCCGGTCGTGGA
TGGGTTGCCCGATGAAACCTCCTCGCGGGTATACCCGTACTTTGTATCTACAGTCTACGACTCATTGGTGGGACC
AACAGCAGGCTCTATACCGGATTTCCGGTCCATATGTGAAAGATTGTGGCCTCGGTTTGTTGCGCCTGTAGTGAA
TGGCGAAACACCCCCGGGCGGGAACAGTGAGTGGGATTTCTCGCGGTTGCTTGTCAAAAACAGAGTCATCTTTCG
ACATCAGGGCGAGTCTGCGCTGGTGCACCACATTGTTCCCGATGAGACTCCTGCTGGCGAGAAACGGACCACGCT
GGCAAAAACCGCTATGCCTTCGGCCCTCCCTTCTCTGCCATATTTCTCGACCTTGATCCTCACATCCGCATATCT
GGCCTCGCACACGCCTCAACGACTAGATACAATCTTCTTCTCTAAATTCTCCTCTTCATCCCTTTCAGCCCGGAA
CAAGCGTGCCCACCACCGTCGACGTTTGAAAGTCCTCTCCCAAGCCCAGGCCGAAGAGAGACAAGCCGCAAACGA
TGACCCTTCAACCCCCAACAAGAAAGGAAAGCGAACTAAAACTCGCATTACAAAATCAACACTATCATCCGCCTT
TGCGACCTCCTCGGCCACCACATCAGCTGTCGGCGGTGGCGCAGGCATCGCCGGCCCGTCCACCATCCTTACAGC
CCGTTCTTTCCCCCTAGAACGTCTCCTGGCCATCTACCATGCGATCGACCCAAACCCCCCAGCAACACCACTTCG
AGTTTCAGCCGTTGCAGACCGTATCTACGCCGAACTGGCAACCCTGCGACGCCTGCGGCTCGTTGTCCCCGCTGC
TAGCCACAATGCCATGGCGACTAGTAGTGGGAATACCACTGCCGATGCGGGAGATAAGTGGTGTGTCAACGTCTC
TGGCGACTGGGTCGGTGAGCTGGCTAAGGGTATTGGTGTCGAGGTTGGTGAGTGGTTGGCTGGCGGTCTGGACTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail