Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4523.t1
Gene name
Locationscaffold_09:466722..471453
Strand-
Gene length (bp)4731
Transcript length (bp)4605
Coding sequence length (bp)4605
Protein length (aa) 1535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14701 hDGE_amylase Glycogen debranching enzyme, glucanotransferase domain 1.1E-183 135 572
PF06202 GDE_C Amylo-alpha-1,6-glucosidase 1.7E-118 1055 1525
PF14702 hGDE_central Central domain of human glycogen debranching enzyme 1.1E-83 737 980
PF14699 hGDE_N N-terminal domain from the human glycogen debranching enzyme 5.8E-29 37 133

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4523.t1
MASPRQVYLLPLKDDGSPDVPGGYIYLASPPESGYVLRFIIEGTSSICRQGSLWVNIPEEGKPFERHSFREFRLQ
PNFSENIQIDIPVTFAGAFAFYTTFSPLPEFSVDKVSTPKPTKTPVHYIDVSPKLTVQGKDLPLNALSIFSVISK
FMGQYPTDWDRHLRGIGQRNYNMVHFTPLMHRGSSNSPYSIFDQLTFDPAFFPNGEDDIATLVAKMEKDYGLLTL
TDVVWNHTANNSKWLEEHPESGYSVETAPWLESALELDTALLKFGDSLKDAGLPTEFKTEQDLVTVMNAARKEAI
DGTRLWEFYVLDVKNDVKKIIDEWINADIDPALVQSGEMQQFKHWSLTQQANVLRELGIPTVQQIRGRFGRAVDP
KFGAVALNVLFGDYDKGHTDLAEVEHALSHILDEANLPFYKEYDADVDAIMDQLFNRIKYLRIEDHGPKMGPVTK
ENPLIETYFTRLPLNDITKNHDPKALALVNNGWIWNADAMKDNAGPDSRAYLRREVIVWGDCVKLRYGSSPEDNP
FLWDYMSQYTRLMAKYFSGFRIDNCHSTPLVVAEHLLDEARKVRPDLTVFAELFTGSEEADYVFVKRLGINALIR
EAMQAWSTEELSRLVHRHGGQPIGSFEMDLPSAGSSHAIASARSRKSGEKITHIRPCPVPALFMDCTHDNELPAQ
KRDARDTLPNAALVAMCASATGSVMGYDEVYPKLIDLVHETRQYTSHSSNSETLAVGSGEGGIGGVKKVLNELHT
MMGVEGYDETHIHHDGEYITVHRVHPKTRKGIFLVAHTAFPGNESGAILAPTHIACTSAKHIGSWQLEVDASDET
KAKILGDDKYLKGLPSHTRDIEGAVIEQDDKDLKISVLGSLVPGSIALFETWIPGADHANGFENNLADGADDAFS
ELSLIDLNFVLYRCEAEERDSSDGQDGIYSIPKLEPMVYAGLQGWWSILEDIIKYNQIGHPLCDHLREGQWALDY
ITGRLERAATREGCVALKTPAAWLREKFNAVRDLPNFLFPRYFAIVLQVAYNAAWKRGIHLLGENVRHGQEFIHQ
LAMVSVQQTGYVKSASLWPTKMVPSLAAGLPHFAVDWTRCWGRDIFISIRGLFLCTQRFDDAKEHILAFASVIKH
GMIPNLLSSGKLPRYNSRDSVWFFLQAIQDFTEMAPNGIDILQEKVPRRFLPYDDTWFPFDDSRAYSQSPTLLEC
VQEVFQRHASGISFREYNAGPDLDCQMKPEGFQIDVKVDWETGLIFGGNQDNCGTWQDKMGESTKAGNKGVPGTP
RDGAAIEITGLAYSALAWVARLHESKAYPHEGVDISDGKKITFAEWARKIKDNFERCYYVPLDPSEDSQYDVDAK
IVNRRGIYKDLYKSGKPYEDYQLRSNFPIAMSVARDLFTPAKALIALSIADSTIVGPVGMATLDPSDLNYRPYYI
NSDDSSDFATAKGRNYHQGPEWVWQRGYFLRALLHFDLLRRKTPGERTECFQQVTRRLYGCKKALQESPWKGLTE
LTNKTGEYCNDSSPTQSWSAGCLLDLYYDASMHS*
Coding >Pro_DTO377G3_2|g4523.t1
ATGGCCTCCCCACGTCAGGTCTACTTGCTTCCTTTGAAGGATGACGGTTCTCCAGACGTGCCTGGTGGGTACATT
TACCTGGCCTCTCCGCCAGAATCCGGATATGTGCTTCGATTCATCATCGAGGGAACGAGCTCCATTTGCCGACAA
GGCAGTCTCTGGGTGAATATTCCCGAGGAGGGAAAGCCCTTTGAACGTCACTCATTCCGGGAGTTCAGACTGCAG
CCCAACTTCAGTGAGAACATTCAAATCGATATTCCTGTGACATTCGCGGGCGCGTTTGCTTTCTATACAACATTT
TCTCCGCTGCCAGAGTTCTCGGTCGACAAGGTGTCTACCCCGAAGCCGACGAAGACACCTGTTCACTACATTGAT
GTGTCGCCCAAACTTACCGTTCAGGGGAAAGATTTGCCGCTTAATGCACTCTCTATCTTCTCGGTAATCTCAAAG
TTCATGGGTCAATATCCAACAGACTGGGATAGACACCTTCGTGGGATCGGTCAGCGGAACTACAACATGGTTCAT
TTCACACCCCTGATGCACCGTGGCTCGTCCAACTCGCCCTATAGTATTTTTGATCAATTAACATTCGATCCCGCA
TTTTTCCCTAATGGAGAAGATGATATCGCTACATTGGTTGCGAAGATGGAGAAAGACTATGGCCTTCTCACATTG
ACTGATGTGGTATGGAACCACACAGCTAATAACAGCAAGTGGCTGGAGGAGCATCCCGAGTCTGGTTACAGTGTG
GAGACCGCGCCATGGCTGGAGTCAGCCCTCGAGCTAGACACGGCGCTTTTGAAATTCGGCGATAGCCTCAAGGAC
GCCGGTCTTCCGACAGAATTCAAAACGGAGCAGGATCTAGTGACTGTTATGAACGCTGCACGCAAGGAAGCCATT
GATGGAACTCGTCTATGGGAATTCTACGTTCTCGACGTAAAGAATGACGTTAAGAAGATTATAGACGAATGGATC
AATGCAGACATCGATCCTGCGCTTGTCCAAAGCGGCGAGATGCAGCAATTCAAACACTGGTCGCTCACGCAACAA
GCCAATGTTCTCCGCGAGCTTGGAATTCCGACCGTTCAGCAGATTCGCGGACGTTTTGGCCGCGCCGTCGACCCA
AAGTTCGGAGCAGTTGCTCTAAATGTGCTATTTGGAGATTACGATAAGGGCCACACCGACCTTGCTGAGGTTGAA
CACGCCCTGTCCCACATACTCGATGAGGCCAACTTGCCATTCTACAAGGAGTATGATGCAGACGTCGATGCTATC
ATGGACCAACTGTTCAATCGTATCAAGTATCTCAGAATTGAGGATCATGGTCCCAAGATGGGTCCTGTCACCAAG
GAAAACCCATTGATCGAGACTTACTTTACCCGCCTTCCTCTCAATGATATCACGAAAAATCACGACCCTAAAGCC
CTGGCTTTAGTCAATAACGGTTGGATCTGGAATGCCGACGCGATGAAAGATAATGCCGGGCCCGATTCCAGGGCC
TACTTACGCCGCGAAGTTATTGTGTGGGGTGATTGTGTAAAACTTCGATACGGATCCTCTCCTGAAGATAATCCT
TTCCTCTGGGACTATATGTCGCAGTATACCCGTCTCATGGCTAAGTACTTCAGTGGTTTCCGAATCGATAATTGC
CATTCGACACCGCTAGTGGTTGCAGAACATTTGCTGGACGAAGCTCGCAAGGTCCGGCCTGACTTGACTGTGTTT
GCGGAACTATTCACAGGCTCAGAGGAGGCCGACTATGTCTTCGTCAAACGGCTGGGCATCAATGCTCTGATTCGG
GAGGCCATGCAGGCTTGGAGCACAGAAGAGTTGAGTCGTCTTGTTCATCGTCATGGGGGTCAGCCGATCGGAAGC
TTCGAGATGGATTTGCCTTCTGCCGGCAGTAGTCATGCTATTGCGTCAGCTAGGTCTCGCAAGAGTGGCGAAAAG
ATCACTCATATTCGGCCCTGTCCAGTTCCGGCCTTGTTCATGGACTGTACCCATGACAATGAACTCCCTGCCCAG
AAGCGCGATGCTCGAGACACTCTTCCAAATGCTGCACTTGTGGCAATGTGTGCCTCCGCGACTGGAAGTGTAATG
GGCTACGATGAGGTGTATCCCAAACTCATTGATCTTGTCCATGAGACTCGACAATACACCTCTCACTCTTCCAAT
TCCGAGACTCTAGCCGTCGGGTCTGGAGAGGGTGGGATTGGTGGTGTCAAAAAGGTTCTGAATGAACTCCACACT
ATGATGGGAGTTGAAGGCTACGACGAAACTCACATTCATCACGATGGTGAATACATCACTGTGCACCGAGTCCAC
CCTAAAACCAGAAAGGGTATCTTCTTGGTCGCGCATACCGCATTCCCTGGCAATGAGAGTGGTGCGATTCTCGCC
CCAACTCATATTGCCTGTACCAGTGCCAAGCATATCGGATCGTGGCAGCTTGAGGTTGATGCCAGTGATGAAACA
AAGGCGAAGATCCTAGGCGATGACAAGTATTTGAAGGGTCTTCCCAGCCATACCCGGGATATAGAAGGTGCAGTG
ATCGAGCAAGATGACAAAGATCTCAAAATCTCCGTACTGGGTTCCCTTGTTCCCGGATCTATTGCTCTTTTCGAG
ACATGGATTCCCGGAGCAGACCATGCCAATGGATTTGAAAACAACCTCGCCGATGGTGCAGACGACGCATTCTCT
GAGCTCAGCTTGATTGATCTGAACTTTGTGCTATACCGGTGCGAAGCTGAAGAGAGAGATTCTAGCGACGGTCAG
GACGGTATTTACAGCATTCCAAAGCTTGAACCTATGGTCTATGCTGGTCTTCAGGGTTGGTGGAGTATTCTTGAG
GATATCATCAAGTATAACCAAATTGGCCACCCGCTCTGCGATCACTTGCGAGAGGGTCAGTGGGCTTTGGACTAC
ATCACTGGTCGCCTGGAGAGGGCGGCTACTAGGGAAGGATGTGTCGCCTTGAAAACTCCTGCTGCATGGCTTCGT
GAGAAGTTCAACGCTGTCCGCGACTTGCCCAACTTCCTTTTCCCAAGGTATTTCGCAATCGTTCTGCAGGTTGCT
TACAATGCTGCGTGGAAGAGGGGTATTCATCTCCTGGGAGAGAACGTGCGGCATGGCCAGGAATTCATTCATCAA
TTGGCTATGGTCAGCGTACAGCAAACTGGCTATGTGAAATCCGCATCCTTGTGGCCAACCAAGATGGTCCCCAGT
CTTGCAGCCGGACTGCCTCATTTTGCAGTTGACTGGACAAGATGCTGGGGAAGAGATATTTTCATTTCTATCCGT
GGCTTGTTCCTTTGCACTCAACGCTTTGATGACGCTAAGGAGCATATTCTCGCTTTTGCAAGTGTAATCAAGCAT
GGCATGATTCCCAATTTGCTGAGCAGCGGAAAATTGCCACGATACAATTCTCGGGACTCTGTCTGGTTCTTCCTC
CAAGCCATCCAGGACTTCACTGAAATGGCACCCAACGGCATTGATATCTTGCAAGAGAAGGTTCCAAGACGATTC
TTGCCTTATGACGACACTTGGTTCCCCTTCGATGATTCTCGGGCATACTCTCAGTCTCCGACTCTTCTCGAATGC
GTCCAGGAAGTTTTCCAAAGACATGCTTCTGGCATTTCTTTCAGAGAATACAACGCTGGTCCCGACCTTGATTGT
CAGATGAAGCCTGAAGGTTTCCAGATCGACGTTAAGGTTGACTGGGAAACGGGTCTGATTTTCGGTGGCAATCAG
GATAATTGTGGTACTTGGCAAGACAAGATGGGAGAAAGTACCAAGGCTGGAAACAAAGGTGTCCCTGGAACGCCC
CGCGATGGTGCCGCTATTGAGATTACCGGTCTCGCCTACAGCGCTCTGGCATGGGTGGCACGTCTGCATGAATCC
AAGGCGTATCCCCATGAAGGCGTGGATATCTCCGATGGCAAGAAGATTACTTTTGCTGAATGGGCGCGCAAAATC
AAGGACAACTTCGAGCGGTGCTACTATGTTCCCCTTGATCCCAGTGAAGATAGTCAGTACGATGTGGACGCGAAA
ATCGTCAACCGCCGAGGAATCTACAAGGATTTGTACAAGTCTGGCAAGCCCTACGAAGACTACCAGCTCCGCTCC
AACTTCCCCATCGCAATGTCAGTCGCTCGGGATCTATTCACGCCTGCAAAGGCTCTTATCGCTCTGTCAATTGCC
GACTCCACAATCGTGGGCCCTGTGGGTATGGCGACACTGGATCCCTCCGATCTCAACTACCGTCCATACTACATC
AACTCCGATGACTCCAGTGACTTCGCGACTGCCAAGGGTCGCAATTACCATCAGGGTCCAGAGTGGGTCTGGCAA
CGCGGTTACTTCCTCCGTGCTTTATTGCATTTCGATCTCCTGCGCCGAAAGACGCCCGGAGAACGGACTGAATGC
TTCCAGCAGGTCACCCGACGACTCTATGGCTGCAAGAAGGCATTGCAAGAGAGTCCTTGGAAAGGGCTAACAGAA
TTGACGAACAAGACTGGGGAGTATTGTAATGATTCGTCACCCACCCAGTCCTGGTCCGCCGGATGTCTGCTTGAC
CTTTACTATGACGCATCGATGCATTCCTAA
Transcript >Pro_DTO377G3_2|g4523.t1
ATGGCCTCCCCACGTCAGGTCTACTTGCTTCCTTTGAAGGATGACGGTTCTCCAGACGTGCCTGGTGGGTACATT
TACCTGGCCTCTCCGCCAGAATCCGGATATGTGCTTCGATTCATCATCGAGGGAACGAGCTCCATTTGCCGACAA
GGCAGTCTCTGGGTGAATATTCCCGAGGAGGGAAAGCCCTTTGAACGTCACTCATTCCGGGAGTTCAGACTGCAG
CCCAACTTCAGTGAGAACATTCAAATCGATATTCCTGTGACATTCGCGGGCGCGTTTGCTTTCTATACAACATTT
TCTCCGCTGCCAGAGTTCTCGGTCGACAAGGTGTCTACCCCGAAGCCGACGAAGACACCTGTTCACTACATTGAT
GTGTCGCCCAAACTTACCGTTCAGGGGAAAGATTTGCCGCTTAATGCACTCTCTATCTTCTCGGTAATCTCAAAG
TTCATGGGTCAATATCCAACAGACTGGGATAGACACCTTCGTGGGATCGGTCAGCGGAACTACAACATGGTTCAT
TTCACACCCCTGATGCACCGTGGCTCGTCCAACTCGCCCTATAGTATTTTTGATCAATTAACATTCGATCCCGCA
TTTTTCCCTAATGGAGAAGATGATATCGCTACATTGGTTGCGAAGATGGAGAAAGACTATGGCCTTCTCACATTG
ACTGATGTGGTATGGAACCACACAGCTAATAACAGCAAGTGGCTGGAGGAGCATCCCGAGTCTGGTTACAGTGTG
GAGACCGCGCCATGGCTGGAGTCAGCCCTCGAGCTAGACACGGCGCTTTTGAAATTCGGCGATAGCCTCAAGGAC
GCCGGTCTTCCGACAGAATTCAAAACGGAGCAGGATCTAGTGACTGTTATGAACGCTGCACGCAAGGAAGCCATT
GATGGAACTCGTCTATGGGAATTCTACGTTCTCGACGTAAAGAATGACGTTAAGAAGATTATAGACGAATGGATC
AATGCAGACATCGATCCTGCGCTTGTCCAAAGCGGCGAGATGCAGCAATTCAAACACTGGTCGCTCACGCAACAA
GCCAATGTTCTCCGCGAGCTTGGAATTCCGACCGTTCAGCAGATTCGCGGACGTTTTGGCCGCGCCGTCGACCCA
AAGTTCGGAGCAGTTGCTCTAAATGTGCTATTTGGAGATTACGATAAGGGCCACACCGACCTTGCTGAGGTTGAA
CACGCCCTGTCCCACATACTCGATGAGGCCAACTTGCCATTCTACAAGGAGTATGATGCAGACGTCGATGCTATC
ATGGACCAACTGTTCAATCGTATCAAGTATCTCAGAATTGAGGATCATGGTCCCAAGATGGGTCCTGTCACCAAG
GAAAACCCATTGATCGAGACTTACTTTACCCGCCTTCCTCTCAATGATATCACGAAAAATCACGACCCTAAAGCC
CTGGCTTTAGTCAATAACGGTTGGATCTGGAATGCCGACGCGATGAAAGATAATGCCGGGCCCGATTCCAGGGCC
TACTTACGCCGCGAAGTTATTGTGTGGGGTGATTGTGTAAAACTTCGATACGGATCCTCTCCTGAAGATAATCCT
TTCCTCTGGGACTATATGTCGCAGTATACCCGTCTCATGGCTAAGTACTTCAGTGGTTTCCGAATCGATAATTGC
CATTCGACACCGCTAGTGGTTGCAGAACATTTGCTGGACGAAGCTCGCAAGGTCCGGCCTGACTTGACTGTGTTT
GCGGAACTATTCACAGGCTCAGAGGAGGCCGACTATGTCTTCGTCAAACGGCTGGGCATCAATGCTCTGATTCGG
GAGGCCATGCAGGCTTGGAGCACAGAAGAGTTGAGTCGTCTTGTTCATCGTCATGGGGGTCAGCCGATCGGAAGC
TTCGAGATGGATTTGCCTTCTGCCGGCAGTAGTCATGCTATTGCGTCAGCTAGGTCTCGCAAGAGTGGCGAAAAG
ATCACTCATATTCGGCCCTGTCCAGTTCCGGCCTTGTTCATGGACTGTACCCATGACAATGAACTCCCTGCCCAG
AAGCGCGATGCTCGAGACACTCTTCCAAATGCTGCACTTGTGGCAATGTGTGCCTCCGCGACTGGAAGTGTAATG
GGCTACGATGAGGTGTATCCCAAACTCATTGATCTTGTCCATGAGACTCGACAATACACCTCTCACTCTTCCAAT
TCCGAGACTCTAGCCGTCGGGTCTGGAGAGGGTGGGATTGGTGGTGTCAAAAAGGTTCTGAATGAACTCCACACT
ATGATGGGAGTTGAAGGCTACGACGAAACTCACATTCATCACGATGGTGAATACATCACTGTGCACCGAGTCCAC
CCTAAAACCAGAAAGGGTATCTTCTTGGTCGCGCATACCGCATTCCCTGGCAATGAGAGTGGTGCGATTCTCGCC
CCAACTCATATTGCCTGTACCAGTGCCAAGCATATCGGATCGTGGCAGCTTGAGGTTGATGCCAGTGATGAAACA
AAGGCGAAGATCCTAGGCGATGACAAGTATTTGAAGGGTCTTCCCAGCCATACCCGGGATATAGAAGGTGCAGTG
ATCGAGCAAGATGACAAAGATCTCAAAATCTCCGTACTGGGTTCCCTTGTTCCCGGATCTATTGCTCTTTTCGAG
ACATGGATTCCCGGAGCAGACCATGCCAATGGATTTGAAAACAACCTCGCCGATGGTGCAGACGACGCATTCTCT
GAGCTCAGCTTGATTGATCTGAACTTTGTGCTATACCGGTGCGAAGCTGAAGAGAGAGATTCTAGCGACGGTCAG
GACGGTATTTACAGCATTCCAAAGCTTGAACCTATGGTCTATGCTGGTCTTCAGGGTTGGTGGAGTATTCTTGAG
GATATCATCAAGTATAACCAAATTGGCCACCCGCTCTGCGATCACTTGCGAGAGGGTCAGTGGGCTTTGGACTAC
ATCACTGGTCGCCTGGAGAGGGCGGCTACTAGGGAAGGATGTGTCGCCTTGAAAACTCCTGCTGCATGGCTTCGT
GAGAAGTTCAACGCTGTCCGCGACTTGCCCAACTTCCTTTTCCCAAGGTATTTCGCAATCGTTCTGCAGGTTGCT
TACAATGCTGCGTGGAAGAGGGGTATTCATCTCCTGGGAGAGAACGTGCGGCATGGCCAGGAATTCATTCATCAA
TTGGCTATGGTCAGCGTACAGCAAACTGGCTATGTGAAATCCGCATCCTTGTGGCCAACCAAGATGGTCCCCAGT
CTTGCAGCCGGACTGCCTCATTTTGCAGTTGACTGGACAAGATGCTGGGGAAGAGATATTTTCATTTCTATCCGT
GGCTTGTTCCTTTGCACTCAACGCTTTGATGACGCTAAGGAGCATATTCTCGCTTTTGCAAGTGTAATCAAGCAT
GGCATGATTCCCAATTTGCTGAGCAGCGGAAAATTGCCACGATACAATTCTCGGGACTCTGTCTGGTTCTTCCTC
CAAGCCATCCAGGACTTCACTGAAATGGCACCCAACGGCATTGATATCTTGCAAGAGAAGGTTCCAAGACGATTC
TTGCCTTATGACGACACTTGGTTCCCCTTCGATGATTCTCGGGCATACTCTCAGTCTCCGACTCTTCTCGAATGC
GTCCAGGAAGTTTTCCAAAGACATGCTTCTGGCATTTCTTTCAGAGAATACAACGCTGGTCCCGACCTTGATTGT
CAGATGAAGCCTGAAGGTTTCCAGATCGACGTTAAGGTTGACTGGGAAACGGGTCTGATTTTCGGTGGCAATCAG
GATAATTGTGGTACTTGGCAAGACAAGATGGGAGAAAGTACCAAGGCTGGAAACAAAGGTGTCCCTGGAACGCCC
CGCGATGGTGCCGCTATTGAGATTACCGGTCTCGCCTACAGCGCTCTGGCATGGGTGGCACGTCTGCATGAATCC
AAGGCGTATCCCCATGAAGGCGTGGATATCTCCGATGGCAAGAAGATTACTTTTGCTGAATGGGCGCGCAAAATC
AAGGACAACTTCGAGCGGTGCTACTATGTTCCCCTTGATCCCAGTGAAGATAGTCAGTACGATGTGGACGCGAAA
ATCGTCAACCGCCGAGGAATCTACAAGGATTTGTACAAGTCTGGCAAGCCCTACGAAGACTACCAGCTCCGCTCC
AACTTCCCCATCGCAATGTCAGTCGCTCGGGATCTATTCACGCCTGCAAAGGCTCTTATCGCTCTGTCAATTGCC
GACTCCACAATCGTGGGCCCTGTGGGTATGGCGACACTGGATCCCTCCGATCTCAACTACCGTCCATACTACATC
AACTCCGATGACTCCAGTGACTTCGCGACTGCCAAGGGTCGCAATTACCATCAGGGTCCAGAGTGGGTCTGGCAA
CGCGGTTACTTCCTCCGTGCTTTATTGCATTTCGATCTCCTGCGCCGAAAGACGCCCGGAGAACGGACTGAATGC
TTCCAGCAGGTCACCCGACGACTCTATGGCTGCAAGAAGGCATTGCAAGAGAGTCCTTGGAAAGGGCTAACAGAA
TTGACGAACAAGACTGGGGAGTATTGTAATGATTCGTCACCCACCCAGTCCTGGTCCGCCGGATGTCTGCTTGAC
CTTTACTATGACGCATCGATGCATTCCTAA
Gene >Pro_DTO377G3_2|g4523.t1
ATGGCCTCCCCACGTCAGGTCTACTTGCTTCCTTTGAAGGATGACGGTTCTCCAGACGTGCCTGGTGGGTACATT
TACCTGGCCTCTCCGCCAGAATCCGGATATGTGCTTCGATTCATCATCGAGGGAACGAGCTCCATTTGCCGACAA
GGCAGTCTCTGGGTGAATATTCCCGAGGAGGGAAAGCCCTTTGAACGTCACTCATTCCGGGAGTTCAGGTAGATC
ATCCCAATTCTTCCTATATGTTGTGTAAATTGAGAGTGCCAGTTGCTGAATAAAAGTAGACTGCAGCCCAACTTC
AGTGAGAACATTCAAATCGATATTCCTGTGACATTCGCGGGCGCGTTTGCTTTCTATACAACATTTTCTCCGCTG
CCAGAGTTCTCGGTCGACAAGGTGTCTACCCCGAAGCCGACGAAGACACCTGTTCACTACATTGATGTGTCGCCC
AAACTTACCGTTCAGGGGAAAGATTTGCCGCTTAATGCACTCTCTATCTTCTCGGTAATCTCAAAGTTCATGGGT
CAATATCCAACAGACTGGGATAGACACCTTCGTGGGATCGGTCAGCGGAACTACAACATGGTTCATTTCACACCC
CTGATGCACCGTGGCTCGTCCAACTCGCCCTATAGTATTTTTGATCAATTAACATTCGATCCCGCATTTTTCCCT
AATGGAGAAGATGATATCGCTACATTGGTTGCGAAGATGGAGAAAGACTATGGCCTTCTCACATTGACTGATGTG
GTATGGAACCACACAGCTAATAACAGCAAGTGGCTGGAGGAGCATCCCGAGTCTGGTTACAGTGTGGAGACCGCG
CCATGGCTGGAGTCAGCCCTCGAGCTAGACACGGCGCTTTTGAAATTCGGCGATAGCCTCAAGGACGCCGGTCTT
CCGACAGAATTCAAAACGGAGCAGGATCTAGTGACTGTTATGAACGCTGCACGCAAGGAAGCCATTGATGGAACT
CGTCTATGGGAATTCTACGTTCTCGACGTAAAGAATGACGTTAAGAAGATTATAGACGAATGGATCAATGCAGAC
ATCGATCCTGCGCTTGTCCAAAGCGGCGAGATGCAGCAATTCAAACACTGGTCGCTCACGCAACAAGCCAATGTT
CTCCGCGAGCTTGGAATTCCGACCGTTCAGCAGATTCGCGGACGTTTTGGCCGCGCCGTCGACCCAAAGTTCGGA
GCAGTTGCTCTAAATGTGCTATTTGGAGATTACGATAAGGGCCACACCGACCTTGCTGAGGTTGAACACGCCCTG
TCCCACATACTCGATGAGGCCAACTTGCCATTCTACAAGGAGTATGATGCAGACGTCGATGCTATCATGGACCAA
CTGTTCAATCGTATCAAGTATCTCAGAATTGAGGATCATGGTCCCAAGATGGGTCCTGTCACCAAGGAAAACCCA
TTGATCGAGACTTACTTTACCCGCCTTCCTCTCAATGATATCACGAAAAATCACGACCCTAAAGCCCTGGCTTTA
GTCAATAACGGTTGGATCTGGAATGCCGACGCGATGAAAGATAATGCCGGGCCCGATTCCAGGGCCTACTTACGC
CGCGAAGTTATTGTGTGGGGTGATTGTGTAAAACTTCGATACGGATCCTCTCCTGAAGATAATCCTTTCCTCTGG
GACTATATGTCGCAGTATACCCGTCTCATGGCTAAGTACTTCAGTGGTTTCCGAATCGATAATTGCCATTCGACA
CCGCTAGTGGTTGCAGAACATTTGCTGGACGAAGCTCGCAAGGTCCGGCCTGACTTGACTGTGTTTGCGGAACTA
TTCACAGGCTCAGAGGAGGCCGACTATGTCTTCGTCAAACGGCTGGGCATCAATGCTCTGATTCGGGAGGCCATG
CAGGCTTGGAGCACAGAAGAGTTGAGTCGTCTTGTTCATCGTCATGGGGGTCAGCCGATCGGAAGCTTCGAGATG
GATTTGCCTTCTGCCGGCAGTAGTCATGCTATTGCGTCAGCTAGGTCTCGCAAGAGTGGCGAAAAGATCACTCAT
ATTCGGCCCTGTCCAGTTCCGGCCTTGTTCATGGACTGTACCCATGACAATGAACTCCCTGCCCAGAAGCGCGAT
GCTCGAGACACTCTTCCAAATGCTGCACTTGTGGCAATGTGTGCCTCCGCGACTGGAAGTGTAATGGGCTACGAT
GAGGTGTATCCCAAACTCATTGATCTTGTCCATGAGACTCGACAATACACCTCTCACTCTTCCAATTCCGAGACT
CTAGCCGTCGGGTCTGGAGAGGGTGGGATTGGTGGTGTCAAAAAGGTTCTGAATGAACTCCACACTATGATGGGA
GTTGAAGGCTACGACGAAACTCACATTCATCACGATGGTGAATACATCACTGTGCACCGAGTCCACCCTAAAACC
AGAAAGGGTATCTTCTTGGTCGCGCATACCGCATTCCCTGGCAATGAGAGTGGTGCGATTCTCGCCCCAACTCAT
ATTGCCTGTACCAGTGCCAAGCATATCGGATCGTGGCAGCTTGAGGTTGATGCCAGTGATGAAACAAAGGCGAAG
ATCCTAGGCGATGACAAGTATTTGAAGGGTCTTCCCAGCCATACCCGGGATATAGAAGGTGCAGTGATCGAGCAA
GATGACAAAGATCTCAAAATCTCCGTACTGGGTTCCCTTGTTCCCGGATCTATTGCTCTTTTCGAGACATGGATT
CCCGGAGCAGACCATGCCAATGGATTTGAAAACAACCTCGCCGATGGTGCAGACGACGCATTCTCTGAGCTCAGC
TTGATTGATCTGAACTTTGTGCTATACCGGTGCGAAGCTGAAGAGAGAGATTCTAGCGACGGTCAGGACGGTATT
TACAGCATTCCAAAGCTTGAACCTATGGTCTATGCTGGTCTTCAGGGTTGGTGGAGTATTCTTGAGGATATCATC
AAGTATAACCAAATTGGCCACCCGCTCTGCGATCACTTGCGAGAGGGTCAGTGGGCTTTGGACTACATCACTGGT
CGCCTGGAGAGGGCGGCTACTAGGGAAGGATGTGTCGCCTTGAAAACTCCTGCTGCATGGCTTCGTGAGAAGTTC
AACGCTGTCCGCGACTTGCCCAACTTCCTTTTCCCAAGGTATTTCGCAATCGTTCTGCAGGTTGCTTACAATGCT
GCGTGGAAGAGGGGTATTCATCTCCTGGGAGAGAACGTGCGGCATGGCCAGGAATTCATTCATCAATTGGCTATG
GTCAGCGTACAGCAAACTGGCTATGTGAAATCCGCATCCTTGTGGCCAACCAAGATGGTCCCCAGTCTTGCAGCC
GGACTGCCTCATTTTGCAGTTGACTGGACAAGATGCTGGGGAAGAGATATTTTCATTTCTATCCGTGGCTTGTTC
CTTTGCACTCAACGCTTTGATGACGCTAAGGAGCATATTCTCGCTTTTGCAAGTGTAATCAAGCATGGCATGATT
CCCAATTTGCTGAGCAGCGGAAAATTGCCACGATACAATTCTCGGGACTCTGTCTGGTTCTTCCTCCAAGCCATC
CAGGACTTCACTGAAATGGCACCCAACGGCATTGATATCTTGCAAGAGAAGGTTCCAAGACGATTCTTGCCTTAT
GACGACACTTGGTTCCCCTTCGATGATTCTCGGGCATACTCTCAGTCTCCGACTCTTCTCGAATGCGTCCAGGAA
GTTTTCCAAAGACATGCTTCTGGCATTTCTTTCAGAGAATACAACGCTGGTCCCGACCTTGATTGTCAGATGAAG
CCTGAAGGTTTCCAGATCGACGTTAAGGTTGACTGGGAAACGGGTCTGATTTTCGGTGGCAATCAGGATAATTGT
GGTACTTGGCAAGACAAGATGGGAGAAAGTACCAAGGCTGGAAACAAAGGTGTCCCTGGAACGCCCCGCGATGGT
GCCGCTATTGAGATTACCGGTCTCGCCTACAGCGCTCTGGCATGGGTGGCACGTCTGCATGAATCCAAGGCGTAT
CCCCATGAAGGCGTGGATATCTCCGATGGCAAGAAGATTACTTTTGCTGAATGGGCGCGCAAAATCAAGGACAAC
TTCGAGCGGTGCTACTATGTTCCCCTTGATCCCAGTGAAGATAGTCAGTACGATGTGGACGCGAAAATCGTCAAC
CGCCGAGGAATCTACAAGGATTTGTACAAGTCTGGCAAGCCCTACGAAGACTACCAGCTCCGCTCCAACTTCCCC
ATCGCAATGTCAGTCGCTCGGGATCTATTCACGCCTGCAAAGGCTCTTATCGCTCTGTCAATTGCCGACTCCACA
ATCGTGGGCCCTGTGGGTATGGCGACACTGGATCCCTCCGATCTCAACTACCGTCCATACTACATCAACTCCGAT
GACTCCAGTGACTTCGCGACTGCCAAGGGTCGCAATTACCATCAGGGTCCAGAGTGGGTCTGGCAACGCGGTTAC
TTCCTCCGTGCTTTATTGCATTTCGATCTCCTGCGCCGAAAGACGCCCGGAGAACGGACTGAATGCTTCCAGCAG
GTCACCCGACGACTCTATGGCTGCAAGAAGGCATTGCAAGAGAGTCCTTGGAAAGGGCTAACAGAATTGACGAAC
AAGACTGGGGAGTATTGTAATGATTCGGTAAGTTACTTTCGTTTCGATAAATTTCTCATTTGTACAGGATACTAA
CGAAAAACACAGTCACCCACCCAGTCCTGGTCCGCCGGATGTCTGCTTGACCTTTACTATGACGCATCGATGCAT
TCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail