Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4522.t1
Gene name
Locationscaffold_09:463499..466174
Strand-
Gene length (bp)2675
Transcript length (bp)2499
Coding sequence length (bp)2499
Protein length (aa) 833

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 2.6E-79 429 706
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 6.8E-42 220 417
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 2.1E-39 39 200

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 120 139 19
3 176 198 22
4 429 451 22
5 480 502 22
6 523 545 22
7 560 582 22
8 587 608 21
9 623 645 22
10 650 672 22
11 687 709 22
12 716 733 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4522.t1
MSLTASAACAALTLLADKPDDGSKRPWRPNDPVKEQRDLYTQFVISSALGLIAFLTFCILRPKWTELYAARRRQR
NAASQLPELPDTLFGWIPVLHRITEEEVLQSAGLDAYVFMSFFKFAIRFLLAVFIFAVAIILPMHYKYTGQYGVP
GWDNVPGNDTMSSLGGIEKEKPVTDPGYLWIYVLFAYVFSGLAIYMLLDETKVIIRTRQSYLGNQTSTTDRTIRL
SGIPNDLGTEDKIKEFVEGLRVGKVESITVCRKWRELDELIDERMKVIRELERAWTKHMGYKRPKNDGNTLPLTE
QQPRDADDERSGLLSGHENEHVSEYSNERPKTRIWYGPLKLRFRMIDAIDYYEEKLRKIDEHIKNAREKEYPTTE
IAFVTMESIAASQMLVQAILDPHPMQMFARLAPAPADVIWKNTYLSRTRRMVQSWSITMVIGFLTVFWSVLLVPI
ASLLELKTLETIVPRLAEFLQEHPIVKSLVQTGLPTLAFSLLTVAVPYLYEWLSNNQGMVSRGDVQLSVISKNFF
FSFFNLFLLFTVFGTASGFYGFWESLRDAFKDSTTIALALANSLEGLAPFYINLLILQGLGLFPFRLLEFGSVAL
YPFQFLSARTPREYAELSTPPKFSYGFSIPQTILILVICVVYSVFPSSWLICLFGLIYFTVGKFIYKYQLLYAMD
HQQHSTGRAWPMICNRVFVGLLVHQLAMIGVLALRRAITRSLLLVPLLGFTVWFSYWFGRTYEPLMKFIALKSIN
RDQPGGGDISPSPSSTFSPPSGLDRDSFPIRIGGHDLDLRLRKYVNPSLIIPLDAAWLPGPNPARGNGNGASALD
VHPTQSV*
Coding >Pro_DTO377G3_2|g4522.t1
ATGTCTCTTACGGCATCAGCAGCCTGCGCTGCGTTGACATTGCTTGCCGACAAGCCTGATGACGGAAGCAAAAGG
CCATGGCGTCCCAACGACCCTGTGAAAGAACAGCGCGATCTATACACGCAGTTTGTAATTAGCTCTGCGCTTGGT
CTCATCGCCTTTTTGACGTTCTGTATTTTGCGACCAAAATGGACCGAGTTGTATGCTGCCCGACGACGACAAAGA
AATGCTGCTTCGCAGTTACCTGAGCTTCCAGATACCCTTTTTGGTTGGATTCCCGTTCTTCATCGGATTACAGAA
GAGGAGGTGCTGCAGTCTGCGGGCCTAGATGCATATGTGTTCATGTCTTTCTTCAAGTTTGCGATCCGATTTCTT
CTGGCTGTCTTTATCTTCGCTGTTGCCATCATCCTCCCTATGCACTACAAATACACCGGCCAATATGGAGTTCCT
GGCTGGGATAACGTCCCCGGCAATGATACCATGAGTTCACTTGGTGGAATCGAAAAAGAAAAGCCAGTTACAGAC
CCTGGATATCTTTGGATATACGTACTGTTCGCATATGTCTTCAGTGGCTTGGCCATCTACATGCTTCTTGACGAG
ACAAAAGTAATTATTCGCACTCGGCAATCCTATCTCGGGAATCAGACAAGCACCACTGATCGCACCATTCGTCTG
TCCGGAATCCCGAATGACTTGGGAACCGAAGATAAGATCAAAGAATTCGTGGAAGGCCTGCGAGTCGGCAAAGTG
GAGAGTATCACGGTGTGCCGAAAGTGGCGGGAGCTGGACGAATTGATCGACGAGAGAATGAAAGTCATTCGTGAA
CTTGAGAGAGCATGGACAAAACATATGGGATACAAGCGACCAAAGAACGATGGAAATACATTGCCGCTGACGGAG
CAACAACCCCGTGATGCAGACGATGAACGGTCCGGACTCCTGTCCGGACACGAGAACGAGCATGTCTCGGAGTAT
TCGAATGAAAGACCCAAGACTCGTATCTGGTATGGTCCATTGAAGCTTCGTTTCCGGATGATCGATGCAATCGAT
TACTATGAGGAGAAGCTACGGAAGATTGATGAACATATCAAAAACGCCCGAGAGAAAGAATATCCTACTACCGAG
ATTGCTTTCGTCACGATGGAGTCAATCGCCGCGTCTCAAATGCTTGTTCAAGCGATCCTTGATCCACACCCAATG
CAGATGTTCGCTCGACTTGCACCGGCGCCGGCAGATGTTATTTGGAAAAACACTTACTTGTCGCGTACTCGACGA
ATGGTTCAGTCATGGTCCATCACCATGGTCATTGGATTCCTCACCGTGTTTTGGTCTGTGCTCTTGGTTCCTATT
GCCTCATTGCTGGAGCTGAAGACACTTGAGACGATTGTCCCTCGGCTGGCAGAATTCCTCCAGGAACATCCGATC
GTCAAGTCGTTGGTTCAGACCGGATTGCCTACCCTCGCATTCTCGCTGTTGACAGTAGCTGTGCCTTATCTCTAT
GAGTGGCTCTCGAACAACCAAGGAATGGTGTCACGTGGGGATGTTCAGCTCTCCGTGATCTCCAAGAATTTCTTC
TTCTCGTTCTTCAATTTGTTCCTTCTGTTCACTGTGTTTGGAACAGCGAGTGGCTTCTATGGGTTCTGGGAAAGT
CTTCGGGATGCATTTAAAGATTCTACAACAATTGCCCTCGCATTGGCCAATTCCCTCGAAGGCCTGGCTCCATTC
TACATCAACCTGTTGATTCTGCAGGGATTGGGCCTTTTCCCCTTCCGACTCCTCGAATTCGGAAGTGTCGCACTC
TACCCCTTCCAATTCCTATCAGCACGCACGCCACGGGAATATGCGGAGCTGTCAACTCCTCCCAAGTTCAGCTAC
GGTTTCTCCATCCCGCAAACCATCTTGATATTAGTCATCTGTGTGGTTTACAGTGTGTTCCCGAGCTCGTGGCTG
ATCTGCCTATTCGGGCTGATCTACTTCACAGTCGGCAAATTTATCTACAAATACCAACTGCTATATGCCATGGAT
CACCAGCAACATTCCACTGGCCGCGCGTGGCCGATGATTTGCAATCGCGTGTTTGTGGGGCTGTTGGTTCATCAG
CTGGCCATGATTGGTGTTCTGGCTCTGCGCCGAGCTATCACGCGGTCGCTACTCCTGGTGCCACTTCTAGGCTTC
ACCGTTTGGTTTTCATACTGGTTTGGGCGTACATACGAGCCCCTGATGAAGTTCATTGCCCTCAAGAGTATCAAT
CGGGACCAGCCGGGTGGTGGCGACATCTCCCCCTCGCCTTCATCGACCTTCTCACCGCCATCAGGCCTAGATCGC
GATAGCTTTCCGATACGCATTGGCGGACATGACCTCGATTTGCGGCTGAGGAAGTACGTCAACCCGAGCTTGATT
ATCCCGTTGGATGCTGCCTGGCTCCCTGGTCCCAACCCCGCTCGAGGCAACGGAAACGGCGCGTCCGCGCTGGAC
GTCCATCCGACACAGAGCGTTTGA
Transcript >Pro_DTO377G3_2|g4522.t1
ATGTCTCTTACGGCATCAGCAGCCTGCGCTGCGTTGACATTGCTTGCCGACAAGCCTGATGACGGAAGCAAAAGG
CCATGGCGTCCCAACGACCCTGTGAAAGAACAGCGCGATCTATACACGCAGTTTGTAATTAGCTCTGCGCTTGGT
CTCATCGCCTTTTTGACGTTCTGTATTTTGCGACCAAAATGGACCGAGTTGTATGCTGCCCGACGACGACAAAGA
AATGCTGCTTCGCAGTTACCTGAGCTTCCAGATACCCTTTTTGGTTGGATTCCCGTTCTTCATCGGATTACAGAA
GAGGAGGTGCTGCAGTCTGCGGGCCTAGATGCATATGTGTTCATGTCTTTCTTCAAGTTTGCGATCCGATTTCTT
CTGGCTGTCTTTATCTTCGCTGTTGCCATCATCCTCCCTATGCACTACAAATACACCGGCCAATATGGAGTTCCT
GGCTGGGATAACGTCCCCGGCAATGATACCATGAGTTCACTTGGTGGAATCGAAAAAGAAAAGCCAGTTACAGAC
CCTGGATATCTTTGGATATACGTACTGTTCGCATATGTCTTCAGTGGCTTGGCCATCTACATGCTTCTTGACGAG
ACAAAAGTAATTATTCGCACTCGGCAATCCTATCTCGGGAATCAGACAAGCACCACTGATCGCACCATTCGTCTG
TCCGGAATCCCGAATGACTTGGGAACCGAAGATAAGATCAAAGAATTCGTGGAAGGCCTGCGAGTCGGCAAAGTG
GAGAGTATCACGGTGTGCCGAAAGTGGCGGGAGCTGGACGAATTGATCGACGAGAGAATGAAAGTCATTCGTGAA
CTTGAGAGAGCATGGACAAAACATATGGGATACAAGCGACCAAAGAACGATGGAAATACATTGCCGCTGACGGAG
CAACAACCCCGTGATGCAGACGATGAACGGTCCGGACTCCTGTCCGGACACGAGAACGAGCATGTCTCGGAGTAT
TCGAATGAAAGACCCAAGACTCGTATCTGGTATGGTCCATTGAAGCTTCGTTTCCGGATGATCGATGCAATCGAT
TACTATGAGGAGAAGCTACGGAAGATTGATGAACATATCAAAAACGCCCGAGAGAAAGAATATCCTACTACCGAG
ATTGCTTTCGTCACGATGGAGTCAATCGCCGCGTCTCAAATGCTTGTTCAAGCGATCCTTGATCCACACCCAATG
CAGATGTTCGCTCGACTTGCACCGGCGCCGGCAGATGTTATTTGGAAAAACACTTACTTGTCGCGTACTCGACGA
ATGGTTCAGTCATGGTCCATCACCATGGTCATTGGATTCCTCACCGTGTTTTGGTCTGTGCTCTTGGTTCCTATT
GCCTCATTGCTGGAGCTGAAGACACTTGAGACGATTGTCCCTCGGCTGGCAGAATTCCTCCAGGAACATCCGATC
GTCAAGTCGTTGGTTCAGACCGGATTGCCTACCCTCGCATTCTCGCTGTTGACAGTAGCTGTGCCTTATCTCTAT
GAGTGGCTCTCGAACAACCAAGGAATGGTGTCACGTGGGGATGTTCAGCTCTCCGTGATCTCCAAGAATTTCTTC
TTCTCGTTCTTCAATTTGTTCCTTCTGTTCACTGTGTTTGGAACAGCGAGTGGCTTCTATGGGTTCTGGGAAAGT
CTTCGGGATGCATTTAAAGATTCTACAACAATTGCCCTCGCATTGGCCAATTCCCTCGAAGGCCTGGCTCCATTC
TACATCAACCTGTTGATTCTGCAGGGATTGGGCCTTTTCCCCTTCCGACTCCTCGAATTCGGAAGTGTCGCACTC
TACCCCTTCCAATTCCTATCAGCACGCACGCCACGGGAATATGCGGAGCTGTCAACTCCTCCCAAGTTCAGCTAC
GGTTTCTCCATCCCGCAAACCATCTTGATATTAGTCATCTGTGTGGTTTACAGTGTGTTCCCGAGCTCGTGGCTG
ATCTGCCTATTCGGGCTGATCTACTTCACAGTCGGCAAATTTATCTACAAATACCAACTGCTATATGCCATGGAT
CACCAGCAACATTCCACTGGCCGCGCGTGGCCGATGATTTGCAATCGCGTGTTTGTGGGGCTGTTGGTTCATCAG
CTGGCCATGATTGGTGTTCTGGCTCTGCGCCGAGCTATCACGCGGTCGCTACTCCTGGTGCCACTTCTAGGCTTC
ACCGTTTGGTTTTCATACTGGTTTGGGCGTACATACGAGCCCCTGATGAAGTTCATTGCCCTCAAGAGTATCAAT
CGGGACCAGCCGGGTGGTGGCGACATCTCCCCCTCGCCTTCATCGACCTTCTCACCGCCATCAGGCCTAGATCGC
GATAGCTTTCCGATACGCATTGGCGGACATGACCTCGATTTGCGGCTGAGGAAGTACGTCAACCCGAGCTTGATT
ATCCCGTTGGATGCTGCCTGGCTCCCTGGTCCCAACCCCGCTCGAGGCAACGGAAACGGCGCGTCCGCGCTGGAC
GTCCATCCGACACAGAGCGTTTGA
Gene >Pro_DTO377G3_2|g4522.t1
ATGTCTCTTACGGCATCAGCAGCCTGCGCTGCGTTGACATTGCTTGCCGACAAGCCTGATGACGGAAGCAAAAGG
CCATGGCGTCCCAACGACCCTGTGAAAGAACAGCGCGATCTATACACGCAGTTTGTAATTAGCTCTGCGCTTGGT
CTCATCGCCTTTTTGACGTTCTGTGTAAGTATCTCTGTTACTGTGAGGTGTCGTCAATCGCTGACTGCCTTGCTT
ATAGATTTTGCGACCAAAATGGACCGAGTTGTATGCTGCCCGACGACGACAAAGAAATGCTGCTTCGCAGTTACC
TGAGCTTCCAGATACCCTTTTTGGTTGGATTCCCGTTCTTCATCGGATTACAGAAGAGGAGGTGCTGCAGTCTGC
GGGCCTAGATGCATATGTGGTATGTTCGAATGCTATGGCTTCTCCAGACAATGCATGGACACTTGCTGACTTGAG
TCTTTGGGCAGTTCATGTCTTTCTTCAAGTTTGCGATCCGATTTCTTCTGGCTGTCTTTATCTTCGCTGTTGCCA
TCATCCTCCCTATGCACTACAAATACACCGGCCAATATGGAGTTCCTGGCTGGGATAACGTCCCCGGCAATGATA
CCATGAGTTCACTTGGTGGAATCGAAAAAGAAAAGCCAGTTACAGACCCTGGATATCTTTGGATATACGTACTGT
TCGCATATGTCTTCAGTGGCTTGGCCATCTACATGCTTCTTGACGAGACAAAAGTAATTATTCGCACTCGGCAAT
CCTATCTCGGGAATCAGACAAGCACCACTGATCGCACCATTCGTCTGTCCGGAATCCCGAATGACTTGGGAACCG
AAGATAAGATCAAAGAATTCGTGGAAGGCCTGCGAGTCGGCAAAGTGGAGAGTATCACGGTGTGCCGAAAGTGGC
GGGAGCTGGACGAATTGATCGACGAGAGAATGAAAGTCATTCGTGAACTTGAGAGAGCATGGACAAAACATATGG
GATACAAGCGACCAAAGAACGATGGAAATACATTGCCGCTGACGGAGCAACAACCCCGTGATGCAGACGATGAAC
GGTCCGGACTCCTGTCCGGACACGAGAACGAGCATGTCTCGGAGTATTCGAATGAAAGACCCAAGACTCGTATCT
GGTATGGTCCATTGAAGCTTCGTTTCCGGATGATCGATGCAATCGATTACTATGAGGAGAAGCTACGGAAGATTG
ATGAACATATCAAAAACGCCCGAGAGAAAGAATATCCTACTACCGAGATTGCTTTCGTCACGATGGAGTCAATCG
CCGCGTCTCAAATGCTTGTTCAAGCGATCCTTGATCCACACCCAATGCAGATGTTCGCTCGACTTGCACCGGCGC
CGGCAGATGTTATTTGGAAAAACACTTACTTGTCGCGTACTCGACGAATGGTTCAGTCATGGTCCATCACCATGG
TCATTGGATTCCTCACCGTGTTTTGGTCTGTGCTCTTGGTTCCTATTGCCTCATTGCTGGAGCTGAAGACACTTG
AGACGATTGTCCCTCGGCTGGCAGAATTCCTCCAGGAACATCCGATCGTCAAGTCGTTGGTTCAGACCGGATTGC
CTACCCTCGCATTCTCGCTGTTGACAGTAGCTGTGCCTTATCTCTATGAGTGTAAGTCTTTGAACATACCCGTTC
TGTAGTTCAAATCGCTAATTATCTTTGCAGGGCTCTCGAACAACCAAGGAATGGTGTCACGTGGGGATGTTCAGC
TCTCCGTGATCTCCAAGAATTTCTTCTTCTCGTTCTTCAATTTGTTCCTTCTGTTCACTGTGTTTGGAACAGCGA
GTGGCTTCTATGGGTTCTGGGAAAGTCTTCGGGATGCATTTAAAGATTCTACAACAATTGCCCTCGCATTGGCCA
ATTCCCTCGAAGGCCTGGCTCCATTCTACATCAACCTGTTGATTCTGCAGGGATTGGGCCTTTTCCCCTTCCGAC
TCCTCGAATTCGGAAGTGTCGCACTCTACCCCTTCCAATTCCTATCAGCACGCACGCCACGGGAATATGCGGAGC
TGTCAACTCCTCCCAAGTTCAGCTACGGTTTCTCCATCCCGCAAACCATCTTGATATTAGTCATCTGTGTGGTTT
ACAGTGTGTTCCCGAGCTCGTGGCTGATCTGCCTATTCGGGCTGATCTACTTCACAGTCGGCAAATTTATCTACA
AATACCAACTGCTATATGCCATGGATCACCAGCAACATTCCACTGGCCGCGCGTGGCCGATGATTTGCAATCGCG
TGTTTGTGGGGCTGTTGGTTCATCAGCTGGCCATGATTGGTGTTCTGGCTCTGCGCCGAGCTATCACGCGGTCGC
TACTCCTGGTGCCACTTCTAGGCTTCACCGTTTGGTTTTCATACTGGTTTGGGCGTACATACGAGCCCCTGATGA
AGTTCATTGCCCTCAAGAGTATCAATCGGGACCAGCCGGGTGGTGGCGACATCTCCCCCTCGCCTTCATCGACCT
TCTCACCGCCATCAGGCCTAGATCGCGATAGCTTTCCGATACGCATTGGCGGACATGACCTCGATTTGCGGCTGA
GGAAGTACGTCAACCCGAGCTTGATTATCCCGTTGGATGCTGCCTGGCTCCCTGGTCCCAACCCCGCTCGAGGCA
ACGGAAACGGCGCGTCCGCGCTGGACGTCCATCCGACACAGAGCGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail