Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g448.t1
Gene name
Locationscaffold_01:1136023..1139097
Strand+
Gene length (bp)3074
Transcript length (bp)2913
Coding sequence length (bp)2913
Protein length (aa) 971

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02862 DDHD DDHD domain 5.7E-15 745 839
PF02862 DDHD DDHD domain 3.4E-09 882 944

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 44.96 27.64 62.29
5d_25C Five days - 25 degrees Celsius 62.56 38.22 86.89
7d_25C Seven days - 25 degrees Celsius 69.57 42.42 96.73
10d_25C Ten days - 25 degrees Celsius 83.88 50.44 117.32
7d_15C Seven days - 15 degrees Celsius 70.18 42.44 97.92
7d_30C Seven days - 30 degrees Celsius 60.79 36.94 84.64

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.130487 no
3d_25C 7d_25C 0.031528 yes
3d_25C 7d_15C 0.031751 yes
3d_25C 7d_30C 0.173434 no
3d_25C 10d_25C 0.001278 yes
5d_25C 7d_25C 0.710163 no
5d_25C 7d_15C 0.679930 no
5d_25C 7d_30C 0.933012 no
5d_25C 10d_25C 0.196058 no
7d_25C 7d_15C 0.980755 no
7d_25C 7d_30C 0.621018 no
7d_25C 10d_25C 0.461166 no
7d_15C 7d_30C 0.595507 no
7d_15C 10d_25C 0.489111 no
7d_30C 10d_25C 0.145986 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g448.t1
MAGPIHTYGPSCLLVDEEPDLTEFQSLQSPPEIRSHFFYISSLPIDDPLAPLPPPTSHGTSNERVPPTPFSARDN
IALEEAWRDLREARKTKSANHRSRPNTSTGTPGIAVPSHESVSNVEHRKAASQEDPSLVGSRGSTLSNPPFFPDD
LPSRSHKSSLTFATGSTGMRIHGLGKENRVGSALGDEFKHDTPRGISIDQKRVRSSSINEFNTPKTSSSPLETEN
VGEGDEVVGSLQADRSHDASMSGSPFIRAPVSQPQTPLGRSFESSSSREGGEWQAELRPSTAPRSAPKPSGLRTT
VSLDQLTQDSEREMTEEPNKQSKIPVGVSRLHLVELPNLKMKPIYWSPLQDISSVVRATWFYKNTMLPVETELAN
KLEAGYVYLKPWSDTWQDELNSCVENGADAELKIVHPLWTKQDSQPSTAQVPQSSDSPLDEAEDPLRFDNNRAAG
GTSIQSETIKSYLTSSAIYVDAKNAQVLRPSLLPSVSRGRRPLSAIRKGHQIGIPVVRGFSRKSWEHLHPSKSNP
IDVRHYIRKTQSKSPSAQGEQICYACKMEESRPSPTDLVLVIHGIGQKLSERMESFHFTHAINAFRREVNMELNN
EPVWPHVRQDHGGIMVLPVNWRTNLSLDDPDVESGIEDPASNNFSLADITPQTLPAIRSLISDVMLDIPYYLSHH
KPKMVKAVIREANRVYRLWCKNNPGFQDSGRVHLIAHSLGSVMAVDILSYQPTHVPQFDFSNTALRSDIFEFDTG
HLFLCGSPVGFFLLLNKASLLPRKGRDKPGSEGDDLLRGVAGEAGQYGCLAVDNLYNIMHTTDPIAYRVNATVDS
GLSNSLKMGTIPSSTASFWQSFGSVFRWNSNPSTLLPSTAPARPAAVSKLPSNVELETHDFTREEIAEKRMLLLN
DNGQIDYYLSGGGGPLNIQYLNMLSAHSSYWTLGDFVRFLVVEIARKQGREGTLLAFRAEKKKGWKYSKG*
Coding >Pro_DTO377G3_2|g448.t1
ATGGCGGGCCCGATCCACACCTACGGTCCGAGTTGCCTGCTTGTGGATGAAGAGCCGGACCTCACCGAATTTCAA
TCGCTTCAATCACCACCAGAAATTCGGTCACATTTCTTCTACATCTCATCATTGCCGATTGACGATCCACTGGCT
CCCCTGCCTCCACCTACAAGCCATGGGACCAGCAATGAGAGAGTTCCTCCCACGCCATTCTCGGCCAGGGATAAC
ATCGCCTTAGAGGAAGCCTGGCGTGATCTACGGGAAGCGAGAAAGACTAAATCCGCGAACCACAGATCCAGGCCA
AATACATCGACAGGGACCCCCGGGATAGCTGTGCCCAGTCATGAATCGGTCTCAAATGTCGAACACCGCAAGGCA
GCCAGCCAAGAGGATCCCTCGTTGGTTGGCAGTAGAGGAAGCACTCTGAGCAACCCTCCTTTCTTCCCGGACGAT
CTGCCCTCCCGCAGTCACAAGAGTTCCCTCACTTTTGCCACAGGCAGTACTGGAATGCGAATCCATGGACTTGGC
AAGGAGAATCGCGTGGGCTCCGCATTGGGTGATGAGTTTAAACACGACACTCCCAGAGGAATTTCCATCGATCAG
AAAAGAGTGCGATCGTCTTCGATCAATGAGTTCAATACACCCAAAACAAGCAGCTCTCCATTGGAGACTGAAAAT
GTGGGTGAAGGCGACGAGGTGGTTGGAAGTCTACAGGCTGATCGTTCTCACGATGCAAGCATGAGTGGCTCTCCC
TTTATACGGGCGCCGGTGTCTCAGCCTCAGACGCCGCTTGGTCGCTCATTTGAGTCATCTTCATCAAGAGAAGGA
GGCGAATGGCAGGCGGAACTTCGGCCCAGTACTGCTCCACGAAGTGCCCCGAAACCTTCGGGCCTGAGAACGACC
GTCAGCCTGGATCAATTGACCCAGGACTCGGAGAGGGAGATGACAGAGGAGCCGAACAAACAGTCAAAGATTCCA
GTCGGTGTCTCACGGCTTCATCTAGTCGAGTTACCAAATCTCAAGATGAAACCTATCTACTGGAGTCCTCTTCAG
GACATATCAAGTGTGGTCCGAGCTACGTGGTTCTACAAGAATACCATGTTGCCTGTTGAGACTGAACTTGCGAAC
AAATTGGAGGCAGGCTACGTTTACTTGAAGCCATGGAGTGACACTTGGCAAGATGAATTAAATAGTTGCGTGGAA
AATGGGGCCGATGCCGAGTTGAAAATTGTTCACCCGCTGTGGACAAAACAGGATAGTCAGCCTTCAACTGCACAA
GTGCCACAGAGTAGTGATTCGCCTCTGGATGAGGCGGAGGATCCCTTGAGATTCGACAATAATCGAGCTGCTGGT
GGCACGTCTATTCAATCTGAGACTATCAAGTCATACCTTACATCAAGTGCCATCTATGTCGATGCAAAAAATGCC
CAAGTACTTCGGCCCAGCTTACTTCCCTCAGTGTCAAGGGGACGACGACCTCTTAGTGCAATAAGGAAAGGCCAT
CAGATAGGCATACCTGTGGTTCGCGGCTTTAGTCGAAAATCATGGGAACACCTGCACCCGTCAAAATCCAATCCT
ATTGATGTGCGCCATTACATCCGCAAGACCCAGTCGAAAAGTCCTTCTGCGCAAGGTGAACAAATATGCTATGCA
TGCAAGATGGAAGAATCGCGACCATCTCCAACAGATTTGGTTCTTGTTATCCATGGCATCGGGCAGAAGTTATCA
GAGAGGATGGAAAGCTTCCACTTTACTCATGCCATCAATGCATTTCGGCGAGAGGTGAACATGGAGCTCAACAAC
GAACCTGTTTGGCCGCATGTGCGTCAAGATCATGGGGGAATTATGGTTCTTCCTGTGAATTGGCGCACGAACTTG
TCGTTGGATGACCCCGATGTTGAGTCAGGTATCGAAGACCCAGCTAGCAACAACTTTTCTCTTGCAGATATCACA
CCCCAGACTCTGCCCGCTATTCGATCCTTGATCAGCGATGTGATGCTTGACATTCCTTACTATTTGTCGCACCAT
AAACCGAAGATGGTCAAGGCGGTGATTAGAGAAGCGAACCGTGTGTATCGCCTCTGGTGTAAAAACAACCCAGGG
TTCCAAGACTCCGGCCGCGTACATCTCATCGCTCATTCTCTCGGAAGCGTGATGGCTGTAGACATTCTCAGCTAT
CAGCCAACACATGTTCCTCAGTTTGACTTCTCTAATACGGCTTTACGCAGCGACATTTTTGAGTTCGATACTGGA
CATCTCTTCCTCTGCGGAAGTCCAGTCGGCTTCTTTCTGCTTCTCAATAAGGCTAGCCTTCTTCCCCGAAAAGGC
AGAGACAAGCCAGGTAGCGAAGGTGACGATCTACTTCGTGGGGTTGCCGGCGAAGCAGGTCAATACGGCTGTCTC
GCCGTAGATAATCTCTACAATATCATGCACACAACGGACCCAATTGCGTACCGAGTCAATGCAACAGTAGACTCA
GGCCTTTCCAACTCTCTCAAAATGGGCACTATCCCCAGCTCCACCGCCAGCTTCTGGCAATCATTTGGAAGCGTC
TTTCGCTGGAACTCGAACCCGTCAACATTATTGCCCTCCACAGCTCCTGCCCGCCCCGCAGCAGTATCCAAGCTG
CCATCCAATGTCGAGCTCGAGACCCACGACTTCACTCGCGAAGAGATCGCTGAAAAACGCATGCTTCTGCTAAAT
GACAACGGTCAAATCGATTATTATCTCTCAGGTGGTGGTGGCCCTTTGAATATACAGTACCTCAACATGCTGAGT
GCGCATAGCAGTTACTGGACCTTGGGTGATTTTGTGCGGTTCTTGGTTGTGGAGATTGCGAGAAAGCAGGGGAGA
GAAGGAACGCTGCTTGCCTTTCGGGCTGAGAAGAAGAAGGGATGGAAGTATTCAAAGGGTTGA
Transcript >Pro_DTO377G3_2|g448.t1
ATGGCGGGCCCGATCCACACCTACGGTCCGAGTTGCCTGCTTGTGGATGAAGAGCCGGACCTCACCGAATTTCAA
TCGCTTCAATCACCACCAGAAATTCGGTCACATTTCTTCTACATCTCATCATTGCCGATTGACGATCCACTGGCT
CCCCTGCCTCCACCTACAAGCCATGGGACCAGCAATGAGAGAGTTCCTCCCACGCCATTCTCGGCCAGGGATAAC
ATCGCCTTAGAGGAAGCCTGGCGTGATCTACGGGAAGCGAGAAAGACTAAATCCGCGAACCACAGATCCAGGCCA
AATACATCGACAGGGACCCCCGGGATAGCTGTGCCCAGTCATGAATCGGTCTCAAATGTCGAACACCGCAAGGCA
GCCAGCCAAGAGGATCCCTCGTTGGTTGGCAGTAGAGGAAGCACTCTGAGCAACCCTCCTTTCTTCCCGGACGAT
CTGCCCTCCCGCAGTCACAAGAGTTCCCTCACTTTTGCCACAGGCAGTACTGGAATGCGAATCCATGGACTTGGC
AAGGAGAATCGCGTGGGCTCCGCATTGGGTGATGAGTTTAAACACGACACTCCCAGAGGAATTTCCATCGATCAG
AAAAGAGTGCGATCGTCTTCGATCAATGAGTTCAATACACCCAAAACAAGCAGCTCTCCATTGGAGACTGAAAAT
GTGGGTGAAGGCGACGAGGTGGTTGGAAGTCTACAGGCTGATCGTTCTCACGATGCAAGCATGAGTGGCTCTCCC
TTTATACGGGCGCCGGTGTCTCAGCCTCAGACGCCGCTTGGTCGCTCATTTGAGTCATCTTCATCAAGAGAAGGA
GGCGAATGGCAGGCGGAACTTCGGCCCAGTACTGCTCCACGAAGTGCCCCGAAACCTTCGGGCCTGAGAACGACC
GTCAGCCTGGATCAATTGACCCAGGACTCGGAGAGGGAGATGACAGAGGAGCCGAACAAACAGTCAAAGATTCCA
GTCGGTGTCTCACGGCTTCATCTAGTCGAGTTACCAAATCTCAAGATGAAACCTATCTACTGGAGTCCTCTTCAG
GACATATCAAGTGTGGTCCGAGCTACGTGGTTCTACAAGAATACCATGTTGCCTGTTGAGACTGAACTTGCGAAC
AAATTGGAGGCAGGCTACGTTTACTTGAAGCCATGGAGTGACACTTGGCAAGATGAATTAAATAGTTGCGTGGAA
AATGGGGCCGATGCCGAGTTGAAAATTGTTCACCCGCTGTGGACAAAACAGGATAGTCAGCCTTCAACTGCACAA
GTGCCACAGAGTAGTGATTCGCCTCTGGATGAGGCGGAGGATCCCTTGAGATTCGACAATAATCGAGCTGCTGGT
GGCACGTCTATTCAATCTGAGACTATCAAGTCATACCTTACATCAAGTGCCATCTATGTCGATGCAAAAAATGCC
CAAGTACTTCGGCCCAGCTTACTTCCCTCAGTGTCAAGGGGACGACGACCTCTTAGTGCAATAAGGAAAGGCCAT
CAGATAGGCATACCTGTGGTTCGCGGCTTTAGTCGAAAATCATGGGAACACCTGCACCCGTCAAAATCCAATCCT
ATTGATGTGCGCCATTACATCCGCAAGACCCAGTCGAAAAGTCCTTCTGCGCAAGGTGAACAAATATGCTATGCA
TGCAAGATGGAAGAATCGCGACCATCTCCAACAGATTTGGTTCTTGTTATCCATGGCATCGGGCAGAAGTTATCA
GAGAGGATGGAAAGCTTCCACTTTACTCATGCCATCAATGCATTTCGGCGAGAGGTGAACATGGAGCTCAACAAC
GAACCTGTTTGGCCGCATGTGCGTCAAGATCATGGGGGAATTATGGTTCTTCCTGTGAATTGGCGCACGAACTTG
TCGTTGGATGACCCCGATGTTGAGTCAGGTATCGAAGACCCAGCTAGCAACAACTTTTCTCTTGCAGATATCACA
CCCCAGACTCTGCCCGCTATTCGATCCTTGATCAGCGATGTGATGCTTGACATTCCTTACTATTTGTCGCACCAT
AAACCGAAGATGGTCAAGGCGGTGATTAGAGAAGCGAACCGTGTGTATCGCCTCTGGTGTAAAAACAACCCAGGG
TTCCAAGACTCCGGCCGCGTACATCTCATCGCTCATTCTCTCGGAAGCGTGATGGCTGTAGACATTCTCAGCTAT
CAGCCAACACATGTTCCTCAGTTTGACTTCTCTAATACGGCTTTACGCAGCGACATTTTTGAGTTCGATACTGGA
CATCTCTTCCTCTGCGGAAGTCCAGTCGGCTTCTTTCTGCTTCTCAATAAGGCTAGCCTTCTTCCCCGAAAAGGC
AGAGACAAGCCAGGTAGCGAAGGTGACGATCTACTTCGTGGGGTTGCCGGCGAAGCAGGTCAATACGGCTGTCTC
GCCGTAGATAATCTCTACAATATCATGCACACAACGGACCCAATTGCGTACCGAGTCAATGCAACAGTAGACTCA
GGCCTTTCCAACTCTCTCAAAATGGGCACTATCCCCAGCTCCACCGCCAGCTTCTGGCAATCATTTGGAAGCGTC
TTTCGCTGGAACTCGAACCCGTCAACATTATTGCCCTCCACAGCTCCTGCCCGCCCCGCAGCAGTATCCAAGCTG
CCATCCAATGTCGAGCTCGAGACCCACGACTTCACTCGCGAAGAGATCGCTGAAAAACGCATGCTTCTGCTAAAT
GACAACGGTCAAATCGATTATTATCTCTCAGGTGGTGGTGGCCCTTTGAATATACAGTACCTCAACATGCTGAGT
GCGCATAGCAGTTACTGGACCTTGGGTGATTTTGTGCGGTTCTTGGTTGTGGAGATTGCGAGAAAGCAGGGGAGA
GAAGGAACGCTGCTTGCCTTTCGGGCTGAGAAGAAGAAGGGATGGAAGTATTCAAAGGGTTGA
Gene >Pro_DTO377G3_2|g448.t1
ATGGCGGGCCCGATCCACACCTACGGTCCGAGTTGCCTGCTTGTGGATGAAGAGCCGGACCTCACCGAATTTCAA
TCGCTTCAATCACCACCAGAAATTCGGTCACATTTCTTCTACATCTCATCATTGCCGATTGACGATCCACTGGCT
CCCCTGCCTCCACCTACAAGCCATGGGACCAGCAATGAGAGAGTTCCTCCCACGCCATTCTCGGCCAGGGATAAC
ATCGCCTTAGAGGAAGCCTGGCGTGATCTACGGGAAGCGAGAAAGACTAAATCCGCGAACCACAGATCCAGGCCA
AATACATCGACAGGGACCCCCGGGATAGCTGTGCCCAGTCATGAATCGGTCTCAAATGTCGAACACCGCAAGGCA
GCCAGCCAAGAGGATCCCTCGTTGGTTGGCAGTAGAGGAAGCACTCTGAGCAACCCTCCTTTCTTCCCGGACGAT
CTGCCCTCCCGCAGTCACAAGAGTTCCCTCACTTTTGCCACAGGCAGTACTGGAATGCGAATCCATGGACTTGGC
AAGGAGAATCGCGTGGGCTCCGCATTGGGTGATGAGTTTAAACACGACACTCCCAGAGGAATTTCCATCGATCAG
AAAAGAGTGCGATCGTCTTCGATCAATGAGTTCAATACACCCAAAACAAGCAGCTCTCCATTGGAGACTGAAAAT
GTGGGTGAAGGCGACGAGGTGGTTGGAAGTCTACAGGCTGATCGTTCTCACGATGCAAGCATGAGTGGCTCTCCC
TTTATACGGGCGCCGGTGTCTCAGCCTCAGACGCCGCTTGGTCGCTCATTTGAGTCATCTTCATCAAGAGAAGGA
GGCGAATGGCAGGCGGAACTTCGGCCCAGTACTGCTCCACGAAGTGCCCCGAAACCTTCGGGCCTGAGAACGACC
GTCAGCCTGGATCAATTGACCCAGGACTCGGAGAGGGAGATGACAGAGGAGCCGAACAAACAGTCAAAGATTCCA
GTCGGTGTCTCACGGCTTCATCTAGTCGAGTTACCAAATCTCAAGGTGAGTACAATTTCTACAATTTCTTTACTC
GGCTCTGGCTTACAGTAACGCTTTTTTTATAGATGAAACCTATCTACTGGAGTCCTCTTCAGGACATATCAAGTG
TGGTCCGAGCTACGTGGTTCTACAAGAATACCATGTTGCCTGTTGAGACTGAACTTGCGAACAAATTGGAGGCAG
GCTACGTTTACTTGAAGCCATGGAGTGACACTTGGCAAGATGAATTAAATAGTTGCGTGGAAAATGGGGCCGATG
CCGAGTTGAAAATTGTTCACCCGCTGTGGACAAAACAGGATAGTCAGCCTTCAACTGCACAAGTGCCACAGAGTA
GTGATTCGCCTCTGGATGAGGCGGAGGATCCCTTGAGATTCGACAATAATCGAGCTGCTGGTGGCACGTCTATTC
AATCTGAGACTATCAAGTCATACCTTACATCAAGTGCCATCTATGTCGATGCAAAAAATGCCCAAGTACTTCGGC
CCAGCTTACTTCCCTCAGTGTCAAGGGGACGACGACCTCTTAGTGCAATAAGGAAAGGCCATCAGATAGGCATAC
CTGTGGTTCGCGGCTTTAGTCGAAAATCATGGGAACACCTGCACCCGTCAAAATCCAATCCTATTGATGTGCGCC
ATTACATCCGCAAGACCCAGTCGAAAAGTCCTTCTGCGCAAGGTGAACAAATATGCTATGCATGCAAGATGGAAG
AATCGCGACCATCTCCAACAGATTTGGTTCTTGTTATCCATGGCATCGGGCAGAAGTTATCAGAGAGGATGGAAA
GCTTCCACTTTACTCATGCCATCAATGCATTTCGGCGAGAGGTGAACATGGAGCTCAACAACGAACCTGTTTGGC
CGCATGTGCGTCAAGATCATGGGGGAATTATGGTTCTTCCTGTGAATTGGCGCACGAACTTGTCGTTGGATGACC
CCGATGTTGAGTCAGGTATCGAAGACCCAGCTAGCAACAACTTTTCTCTTGCAGATATCACACCCCAGACTCTGC
CCGCTATTCGATCCTTGATCAGCGATGTGATGCTTGACATTCCTTACTATTTGTCGCACCATAAACCGAAGATGG
TCAAGGCGGTGATTAGAGAAGCGAACCGTGTGTATCGCCTCTGGTGTAAAAACAACCCAGGGTTCCAAGACTCCG
GCCGCGTACATCTCATCGCTCATTCTCTCGGAAGCGTGATGGCTGTAGACATTCTCAGCTATCAGCCAACACATG
TTCCTCAGTTTGACTTCTCTAATACGGCTTTACGCAGCGACATTTTTGAGTTCGATACTGGACATCTCTTCCTCT
GCGGAAGTCCAGTCGGCTTCTTTCTGCTTCTCAATAAGGGTATGTTGAAACCTACATCATTCCGCCTTGTATCTA
ACATTATCCCAGCTAGCCTTCTTCCCCGAAAAGGCAGAGACAAGCCAGGTAGCGAAGGTGACGATCTACTTCGTG
GGGTTGCCGGCGAAGCAGGTCAATACGGCTGTCTCGCCGTAGATAATCTCTACAATATCATGCACACAACGGACC
GTAAGTAGATTGCACAGCCTCTTCGCTTCTTATACTAACCATCTCTACCAGCAATTGCGTACCGAGTCAATGCAA
CAGTAGACTCAGGCCTTTCCAACTCTCTCAAAATGGGCACTATCCCCAGCTCCACCGCCAGCTTCTGGCAATCAT
TTGGAAGCGTCTTTCGCTGGAACTCGAACCCGTCAACATTATTGCCCTCCACAGCTCCTGCCCGCCCCGCAGCAG
TATCCAAGCTGCCATCCAATGTCGAGCTCGAGACCCACGACTTCACTCGCGAAGAGATCGCTGAAAAACGCATGC
TTCTGCTAAATGACAACGGTCAAATCGATTATTATCTCTCAGGTGGTGGTGGCCCTTTGAATATACAGTACCTCA
ACATGCTGAGTGCGCATAGCAGTTACTGGACCTTGGGTGATTTTGTGCGGTTCTTGGTTGTGGAGATTGCGAGAA
AGCAGGGGAGAGAAGGAACGCTGCTTGCCTTTCGGGCTGAGAAGAAGAAGGGATGGAAGTATTCAAAGGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail