Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4460.t1
Gene name
Locationscaffold_09:299631..300583
Strand-
Gene length (bp)952
Transcript length (bp)771
Coding sequence length (bp)771
Protein length (aa) 257

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.2E-47 8 193
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 9.6E-47 13 251
PF08659 KR KR domain 1.1E-05 9 154
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.4E-04 9 105

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 15.37 5.80 24.94
5d_25C Five days - 25 degrees Celsius 22.41 9.63 35.19
7d_25C Seven days - 25 degrees Celsius 31.62 13.70 49.55
10d_25C Ten days - 25 degrees Celsius 15.56 5.38 25.74
7d_15C Seven days - 15 degrees Celsius 42.02 16.67 67.38
7d_30C Seven days - 30 degrees Celsius 21.20 8.66 33.74

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.323910 no
3d_25C 7d_25C 0.029092 yes
3d_25C 7d_15C 0.002297 yes
3d_25C 7d_30C 0.412195 no
3d_25C 10d_25C 0.984214 no
5d_25C 7d_25C 0.338778 no
5d_25C 7d_15C 0.067780 no
5d_25C 7d_30C 0.915674 no
5d_25C 10d_25C 0.348994 no
7d_25C 7d_15C 0.473774 no
7d_25C 7d_30C 0.241789 no
7d_25C 10d_25C 0.030233 yes
7d_15C 7d_30C 0.045367 yes
7d_15C 10d_25C 0.002761 yes
7d_30C 10d_25C 0.441673 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4460.t1
MSLLQDIVVIITGSASGIGLATATAALSQGARILGVDVSSAPVSLNEHPNYKFMQGDLTHETTPRQVVETCIKEF
GGRIDGLLNIAGIMDQNSSVDSLSDYMWERCIAVNLTAPVKLMREVIPIMRQQQSGSIVNVGSKAATSGASSGVA
YTASKHGLMGATKNVAWRYKQEGIRCNAVCPGGVPTGIVQASDPSTWDKDALGTMSLIHQAHAADRQKGLGVEAE
DIADCLLFLISSQSKRINGAIIPIDNAWSVI*
Coding >Pro_DTO377G3_2|g4460.t1
ATGTCGCTGCTTCAAGACATTGTTGTGATAATCACCGGTAGCGCCTCTGGAATTGGACTGGCAACAGCCACAGCA
GCTCTAAGCCAAGGGGCGAGAATTCTAGGTGTTGATGTCTCATCAGCACCTGTCTCACTCAATGAACATCCAAAT
TACAAATTCATGCAAGGTGATCTCACCCATGAGACGACACCAAGGCAGGTGGTAGAGACCTGTATCAAAGAGTTT
GGTGGACGAATCGATGGTCTGCTCAACATTGCTGGTATCATGGACCAGAATTCCAGCGTTGATAGTCTCTCAGAT
TATATGTGGGAACGATGCATTGCAGTCAATTTGACAGCTCCAGTGAAGCTCATGCGTGAGGTTATTCCTATTATG
CGACAGCAACAGAGTGGTAGTATTGTCAACGTCGGCAGCAAGGCAGCTACGAGTGGTGCTTCGTCCGGCGTTGCT
TACACAGCTAGTAAACATGGGCTGATGGGCGCAACCAAAAATGTTGCATGGAGGTACAAACAAGAGGGAATTCGC
TGCAATGCCGTTTGTCCCGGGGGAGTTCCAACCGGTATAGTACAGGCCTCTGACCCAAGCACTTGGGACAAGGAT
GCACTAGGAACAATGTCTCTAATTCACCAGGCACATGCTGCTGATAGGCAGAAAGGACTGGGGGTTGAGGCTGAG
GATATTGCCGACTGTCTTCTATTCCTGATCTCTAGTCAGAGCAAGAGAATTAACGGGGCAATCATTCCCATCGAC
AACGCCTGGTCTGTGATCTAA
Transcript >Pro_DTO377G3_2|g4460.t1
ATGTCGCTGCTTCAAGACATTGTTGTGATAATCACCGGTAGCGCCTCTGGAATTGGACTGGCAACAGCCACAGCA
GCTCTAAGCCAAGGGGCGAGAATTCTAGGTGTTGATGTCTCATCAGCACCTGTCTCACTCAATGAACATCCAAAT
TACAAATTCATGCAAGGTGATCTCACCCATGAGACGACACCAAGGCAGGTGGTAGAGACCTGTATCAAAGAGTTT
GGTGGACGAATCGATGGTCTGCTCAACATTGCTGGTATCATGGACCAGAATTCCAGCGTTGATAGTCTCTCAGAT
TATATGTGGGAACGATGCATTGCAGTCAATTTGACAGCTCCAGTGAAGCTCATGCGTGAGGTTATTCCTATTATG
CGACAGCAACAGAGTGGTAGTATTGTCAACGTCGGCAGCAAGGCAGCTACGAGTGGTGCTTCGTCCGGCGTTGCT
TACACAGCTAGTAAACATGGGCTGATGGGCGCAACCAAAAATGTTGCATGGAGGTACAAACAAGAGGGAATTCGC
TGCAATGCCGTTTGTCCCGGGGGAGTTCCAACCGGTATAGTACAGGCCTCTGACCCAAGCACTTGGGACAAGGAT
GCACTAGGAACAATGTCTCTAATTCACCAGGCACATGCTGCTGATAGGCAGAAAGGACTGGGGGTTGAGGCTGAG
GATATTGCCGACTGTCTTCTATTCCTGATCTCTAGTCAGAGCAAGAGAATTAACGGGGCAATCATTCCCATCGAC
AACGCCTGGTCTGTGATCTAA
Gene >Pro_DTO377G3_2|g4460.t1
ATGTCGCTGCTTCAAGACATTGTAATGCCCCAGCTGCTAACATCTCTCATCGTCCAAATTTCTTACTAATTGCGT
TCTAGGTTGTGATAATCACCGGTAGCGCCTCTGGAATTGGACTGGCAACAGCCACAGCAGCTCTAAGCCAAGGGG
CGAGAATTCTAGGTGTTGATGTCTCATCAGCACCTGTCTCACTCAATGAACATCCAAATTACAAATTCATGCAAG
GTGATCTCACCCATGAGACGACACCAAGGCAGGTGGTAGAGACCTGTATCAAAGAGTTTGGTGGACGAATCGATG
GTCTGCTCAACATTGCTGGTATCATGGACCAGAATTCCAGCGTTGATAGTCTCTCAGATTATATGTGGGAACGAT
GCATTGCAGTCAATTTGACAGCTCCAGTGAAGCTCATGCGTGAGGTTATTCCTATTATGCGACAGCAACAGAGTG
GTAGTATTGTCAACGTCGGCAGCAAGGCAGCTACGAGTGGTGCTTCGTCCGGCGTTGCTTACACAGCTAGTGAGT
ATATCCATATGAATCGAGGTATGCATCAGCATAGTGACAGACCTACTTTCCAGGTAAACATGGGCTGATGGGCGC
AACCAAAAATGTTGCATGGAGGTACAAACAAGAGGGAATTCGCTGCAATGCCGTTTGTCCCGGGGGTACGTGGAC
CAACATATGCTATTAAGATCAAATTTGTGTTAGAAGCTTATGATTTACACTAGGAGTTCCAACCGGTATAGTACA
GGCCTCTGACCCAAGCACTTGGGACAAGGATGCACTAGGAACAATGTCTCTAATTCACCAGGCACATGCTGCTGA
TAGGCAGAAAGGACTGGGGGTTGAGGCTGAGGATATTGCCGACTGTCTTCTATTCCTGATCTCTAGTCAGAGCAA
GAGAATTAACGGGGCAATCATTCCCATCGACAACGCCTGGTCTGTGATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail