Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4418.t1
Gene name
Locationscaffold_09:206749..207341
Strand+
Gene length (bp)592
Transcript length (bp)489
Coding sequence length (bp)489
Protein length (aa) 163

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD 2.5E-51 5 155

GO

GO Term Description Terminal node
GO:0000413 protein peptidyl-prolyl isomerization Yes
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0019538 protein metabolic process No
GO:0008150 biological_process No
GO:0036211 protein modification process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0018208 peptidyl-proline modification No
GO:0003824 catalytic activity No
GO:0043412 macromolecule modification No
GO:0006807 nitrogen compound metabolic process No
GO:0016853 isomerase activity No
GO:0018193 peptidyl-amino acid modification No
GO:0016859 cis-trans isomerase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 75.44 36.55 114.32
5d_25C Five days - 25 degrees Celsius 60.68 27.82 93.54
7d_25C Seven days - 25 degrees Celsius 57.74 26.07 89.41
10d_25C Ten days - 25 degrees Celsius 52.60 23.20 81.99
7d_15C Seven days - 15 degrees Celsius 60.21 27.44 92.98
7d_30C Seven days - 30 degrees Celsius 52.52 23.10 81.95

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.539517 no
3d_25C 7d_25C 0.420514 no
3d_25C 7d_15C 0.520629 no
3d_25C 7d_30C 0.256416 no
3d_25C 10d_25C 0.258762 no
5d_25C 7d_25C 0.912051 no
5d_25C 7d_15C 0.987112 no
5d_25C 7d_30C 0.720348 no
5d_25C 10d_25C 0.723910 no
7d_25C 7d_15C 0.929013 no
7d_25C 7d_30C 0.830245 no
7d_25C 10d_25C 0.833078 no
7d_15C 7d_30C 0.736473 no
7d_15C 10d_25C 0.742387 no
7d_30C 10d_25C 0.998280 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4418.t1
MTTEVAFDTSMGSFSVELYNTHAPKTCKNFATLAERGYYNNVIFHRIIPDFMVQTGDPTGTGRGGSSIYGEKFED
EIRGELKHTGAGILSMANSGPNTNGSQFFITLAPTPWLDGNHTIFGRVKNGMRVIQRMGLVKTGAEDKPVDELKI
IRARVVEAGTQE*
Coding >Pro_DTO377G3_2|g4418.t1
ATGACAACTGAGGTGGCTTTTGACACGTCTATGGGGTCCTTCTCCGTGGAGCTCTACAATACACATGCGCCCAAG
ACATGCAAGAACTTTGCAACCCTCGCTGAACGTGGCTACTACAACAATGTCATCTTCCATCGCATCATTCCTGAC
TTCATGGTCCAAACTGGCGATCCCACTGGCACCGGTCGAGGAGGCAGCTCCATCTACGGCGAGAAATTTGAGGAT
GAGATTCGCGGAGAGCTTAAACACACCGGCGCTGGAATTCTGAGCATGGCGAACAGTGGACCGAACACCAACGGC
AGTCAGTTCTTCATCACTCTCGCGCCGACACCCTGGCTGGACGGGAACCACACGATTTTCGGTCGAGTGAAAAAT
GGCATGAGAGTGATCCAGCGTATGGGACTGGTCAAGACCGGTGCGGAGGACAAGCCAGTGGACGAGTTAAAGATC
ATTCGGGCTCGTGTAGTTGAAGCAGGCACACAAGAGTGA
Transcript >Pro_DTO377G3_2|g4418.t1
ATGACAACTGAGGTGGCTTTTGACACGTCTATGGGGTCCTTCTCCGTGGAGCTCTACAATACACATGCGCCCAAG
ACATGCAAGAACTTTGCAACCCTCGCTGAACGTGGCTACTACAACAATGTCATCTTCCATCGCATCATTCCTGAC
TTCATGGTCCAAACTGGCGATCCCACTGGCACCGGTCGAGGAGGCAGCTCCATCTACGGCGAGAAATTTGAGGAT
GAGATTCGCGGAGAGCTTAAACACACCGGCGCTGGAATTCTGAGCATGGCGAACAGTGGACCGAACACCAACGGC
AGTCAGTTCTTCATCACTCTCGCGCCGACACCCTGGCTGGACGGGAACCACACGATTTTCGGTCGAGTGAAAAAT
GGCATGAGAGTGATCCAGCGTATGGGACTGGTCAAGACCGGTGCGGAGGACAAGCCAGTGGACGAGTTAAAGATC
ATTCGGGCTCGTGTAGTTGAAGCAGGCACACAAGAGTGA
Gene >Pro_DTO377G3_2|g4418.t1
ATGACAACTGAGGTGGCTTTTGACACGTCTATGGTAAATTGTACTTCGTTGTTCTCCCAATCACTTACTAACCCA
TAGCAGGGGTCCTTCTCCGTGGAGCTCTACAATACACATGCGCCCAAGGTATGAGCTCATTCTATAGCTCCTAGA
GAGTCCTCACTAATGTCTTTCTCTTCAGACATGCAAGAACTTTGCAACCCTCGCTGAACGTGGCTACTACAACAA
TGTCATCTTCCATCGCATCATTCCTGACTTCATGGTCCAAACTGGCGATCCCACTGGCACCGGTCGAGGAGGCAG
CTCCATCTACGGCGAGAAATTTGAGGATGAGATTCGCGGAGAGCTTAAACACACCGGCGCTGGAATTCTGAGCAT
GGCGAACAGTGGACCGAACACCAACGGCAGTCAGTTCTTCATCACTCTCGCGCCGACACCCTGGCTGGACGGGAA
CCACACGATTTTCGGTCGAGTGAAAAATGGCATGAGAGTGATCCAGCGTATGGGACTGGTCAAGACCGGTGCGGA
GGACAAGCCAGTGGACGAGTTAAAGATCATTCGGGCTCGTGTAGTTGAAGCAGGCACACAAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail