Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4417.t1
Gene name
Locationscaffold_09:204370..206239
Strand-
Gene length (bp)1869
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04258 Peptidase_A22B Signal peptide peptidase 1.8E-59 82 477

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0004190 aspartic-type endopeptidase activity Yes
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0070001 aspartic-type peptidase activity No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 90 108 18
3 115 137 22
4 187 209 22
5 230 252 22
6 256 275 19
7 288 310 22
8 330 352 22
9 418 437 19
10 447 464 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4417.t1
MADVSPVAELLGQAFYHFDRLRPLLPTYGHLLVSALFPIWIGAHASLTRPSSAAKPAKKQSDKDKDENDTDDEEG
HGPLQKMEGLEPSDALIFPLTAGLTLGGLYLVIKWLEDPAILNKILSFYFSQMGLFFAFAFLKDVLLMIRSFVFP
RYYRQGGRLWKAKQSEHLFMASEDHPAKSHSIRNSPLPGILGYLPLPSMVLGLLWKCRNVSYQRLKVRGHIRGLF
DFRCLVGLLDIVSGSLALSAVGYFAFVANPWWLTNFLGFCFCYGTLQFMSPSTFWTGTLIMGSLFFYDIYFVFFT
PLMVTVATKLDVPIKLLFPRPPTSRDAPGSVPLAMLGLGDIVIPGMMIGLSLRFDLFLYYQRKGAQMARLERSDQ
ATVKPEYQSAIGAWGERFWAPPVKPLQPELQPPYYDARCFPKIYFKASIAGYVVGMVTTLLAMQYSNHAQPALLY
LVPGVLISLWGTAFIRGEIDTMWDFSDAEEVDIEEEKKENEAEDKPSSQEKSLFMRIFSGDYLRASKDENAMRAM
KVKEENIDDSKSETKSSKEGGRNAKTKKPKKDRDSADLISFTVSIPGKPKREMLVNSPTTSTEEEDAEVSVSRDA
NGDNEPPLKRRRRSMMNKSSAN*
Coding >Pro_DTO377G3_2|g4417.t1
ATGGCTGACGTCAGCCCTGTCGCCGAACTTCTTGGACAAGCCTTCTACCACTTCGACCGTCTGAGACCACTTCTT
CCAACTTACGGACACCTACTTGTTTCCGCTCTTTTTCCAATTTGGATCGGTGCACATGCTTCTTTGACAAGACCT
TCTTCCGCCGCTAAACCCGCGAAGAAACAAAGCGACAAGGACAAAGATGAAAATGACACGGATGATGAAGAAGGA
CATGGCCCTTTGCAGAAGATGGAAGGGCTTGAGCCATCAGATGCCCTGATATTCCCGTTGACTGCGGGACTCACC
CTGGGTGGTTTATACTTGGTGATCAAATGGCTGGAAGATCCAGCCATCTTGAACAAGATCCTTAGTTTCTACTTC
TCTCAAATGGGACTCTTCTTTGCCTTTGCATTCCTGAAGGATGTGCTATTGATGATTCGTTCATTTGTGTTTCCT
AGATATTATCGCCAAGGTGGACGATTGTGGAAAGCGAAACAGTCCGAACACCTTTTCATGGCATCCGAGGACCAT
CCAGCCAAGTCACACTCTATCCGGAATTCACCTCTTCCTGGGATTTTGGGTTATCTGCCACTCCCAAGTATGGTA
TTAGGACTGCTTTGGAAGTGCCGAAATGTCTCTTACCAGCGTCTAAAGGTGCGAGGCCATATACGTGGCTTATTT
GACTTTAGATGTCTCGTTGGTCTCCTTGATATCGTCAGCGGAAGTCTTGCATTGTCGGCGGTAGGATACTTTGCA
TTCGTGGCGAACCCATGGTGGTTGACCAACTTCCTCGGTTTCTGCTTCTGCTATGGCACCCTGCAATTCATGTCT
CCCTCCACGTTCTGGACAGGAACGCTCATTATGGGATCCTTATTTTTCTATGATATCTACTTTGTCTTCTTCACA
CCGTTGATGGTCACTGTTGCAACCAAGTTGGATGTACCGATCAAGCTCCTGTTTCCCCGGCCGCCCACCTCTCGT
GATGCTCCTGGCTCTGTGCCGTTGGCCATGCTTGGACTGGGGGACATTGTCATTCCGGGAATGATGATTGGGCTG
TCACTACGCTTCGACCTATTCCTTTATTACCAGCGGAAAGGCGCTCAAATGGCACGTCTTGAAAGGTCGGACCAA
GCAACTGTCAAGCCTGAGTATCAGTCAGCAATCGGCGCTTGGGGAGAGCGGTTCTGGGCGCCACCAGTCAAGCCA
CTCCAGCCGGAACTTCAGCCTCCCTACTATGATGCACGGTGTTTTCCAAAGATCTACTTTAAAGCTAGCATAGCC
GGTTATGTTGTTGGAATGGTCACCACTCTCCTTGCCATGCAATATTCGAATCATGCTCAGCCAGCTCTTCTCTAT
TTGGTACCGGGTGTTTTGATATCGCTCTGGGGTACTGCGTTTATTCGAGGTGAGATTGACACAATGTGGGACTTC
TCTGATGCCGAGGAGGTGGACATTGAAGAGGAAAAGAAGGAAAATGAAGCCGAGGACAAGCCTTCTTCTCAAGAG
AAGAGCCTCTTTATGCGCATCTTCTCCGGTGACTACCTGCGTGCATCAAAAGACGAGAATGCAATGCGGGCTATG
AAAGTCAAAGAAGAGAACATTGATGACTCGAAATCTGAAACGAAATCATCGAAAGAAGGCGGGCGTAATGCCAAG
ACGAAGAAGCCCAAGAAGGACCGTGATAGCGCGGACCTGATCTCCTTCACCGTATCAATCCCTGGCAAGCCTAAA
CGTGAAATGCTGGTCAATTCGCCGACAACTTCCACAGAGGAAGAGGATGCAGAGGTGTCTGTTTCTAGGGATGCT
AATGGGGACAACGAACCGCCGTTGAAGAGAAGACGACGCAGCATGATGAATAAGAGTTCAGCAAACTAG
Transcript >Pro_DTO377G3_2|g4417.t1
ATGGCTGACGTCAGCCCTGTCGCCGAACTTCTTGGACAAGCCTTCTACCACTTCGACCGTCTGAGACCACTTCTT
CCAACTTACGGACACCTACTTGTTTCCGCTCTTTTTCCAATTTGGATCGGTGCACATGCTTCTTTGACAAGACCT
TCTTCCGCCGCTAAACCCGCGAAGAAACAAAGCGACAAGGACAAAGATGAAAATGACACGGATGATGAAGAAGGA
CATGGCCCTTTGCAGAAGATGGAAGGGCTTGAGCCATCAGATGCCCTGATATTCCCGTTGACTGCGGGACTCACC
CTGGGTGGTTTATACTTGGTGATCAAATGGCTGGAAGATCCAGCCATCTTGAACAAGATCCTTAGTTTCTACTTC
TCTCAAATGGGACTCTTCTTTGCCTTTGCATTCCTGAAGGATGTGCTATTGATGATTCGTTCATTTGTGTTTCCT
AGATATTATCGCCAAGGTGGACGATTGTGGAAAGCGAAACAGTCCGAACACCTTTTCATGGCATCCGAGGACCAT
CCAGCCAAGTCACACTCTATCCGGAATTCACCTCTTCCTGGGATTTTGGGTTATCTGCCACTCCCAAGTATGGTA
TTAGGACTGCTTTGGAAGTGCCGAAATGTCTCTTACCAGCGTCTAAAGGTGCGAGGCCATATACGTGGCTTATTT
GACTTTAGATGTCTCGTTGGTCTCCTTGATATCGTCAGCGGAAGTCTTGCATTGTCGGCGGTAGGATACTTTGCA
TTCGTGGCGAACCCATGGTGGTTGACCAACTTCCTCGGTTTCTGCTTCTGCTATGGCACCCTGCAATTCATGTCT
CCCTCCACGTTCTGGACAGGAACGCTCATTATGGGATCCTTATTTTTCTATGATATCTACTTTGTCTTCTTCACA
CCGTTGATGGTCACTGTTGCAACCAAGTTGGATGTACCGATCAAGCTCCTGTTTCCCCGGCCGCCCACCTCTCGT
GATGCTCCTGGCTCTGTGCCGTTGGCCATGCTTGGACTGGGGGACATTGTCATTCCGGGAATGATGATTGGGCTG
TCACTACGCTTCGACCTATTCCTTTATTACCAGCGGAAAGGCGCTCAAATGGCACGTCTTGAAAGGTCGGACCAA
GCAACTGTCAAGCCTGAGTATCAGTCAGCAATCGGCGCTTGGGGAGAGCGGTTCTGGGCGCCACCAGTCAAGCCA
CTCCAGCCGGAACTTCAGCCTCCCTACTATGATGCACGGTGTTTTCCAAAGATCTACTTTAAAGCTAGCATAGCC
GGTTATGTTGTTGGAATGGTCACCACTCTCCTTGCCATGCAATATTCGAATCATGCTCAGCCAGCTCTTCTCTAT
TTGGTACCGGGTGTTTTGATATCGCTCTGGGGTACTGCGTTTATTCGAGGTGAGATTGACACAATGTGGGACTTC
TCTGATGCCGAGGAGGTGGACATTGAAGAGGAAAAGAAGGAAAATGAAGCCGAGGACAAGCCTTCTTCTCAAGAG
AAGAGCCTCTTTATGCGCATCTTCTCCGGTGACTACCTGCGTGCATCAAAAGACGAGAATGCAATGCGGGCTATG
AAAGTCAAAGAAGAGAACATTGATGACTCGAAATCTGAAACGAAATCATCGAAAGAAGGCGGGCGTAATGCCAAG
ACGAAGAAGCCCAAGAAGGACCGTGATAGCGCGGACCTGATCTCCTTCACCGTATCAATCCCTGGCAAGCCTAAA
CGTGAAATGCTGGTCAATTCGCCGACAACTTCCACAGAGGAAGAGGATGCAGAGGTGTCTGTTTCTAGGGATGCT
AATGGGGACAACGAACCGCCGTTGAAGAGAAGACGACGCAGCATGATGAATAAGAGTTCAGCAAACTAG
Gene >Pro_DTO377G3_2|g4417.t1
ATGGCTGACGTCAGCCCTGTCGCCGAACTTCTTGGACAAGCCTTCTACCACTTCGACCGTCTGAGACCACTTCTT
CCAACTTACGGACACCTACTTGTTTCCGCTCTTTTTCCAATTTGGATCGGTGCACATGCTTCTTTGACAAGACCT
TCTTCCGCCGCTAAACCCGCGAAGAAACAAAGCGACAAGGACAAAGATGAAAATGACACGGATGATGAAGAAGGA
CATGGCCCTTTGCAGAAGATGGAAGGGCTTGAGCCATCAGATGCCCTGATATTCCCGTTGACTGCGGGACTCACC
CTGGGTGGTTTATACTTGGTGATCAAATGGCTGGAAGATCCAGCCATCTTGAACAAGATCCTTAGTTTCTACTTC
TCTCAAATGGGACTCTTCTTTGCCTTTGCATTCCTGAAGGATGTGCTATTGATGATTCGTTCATTTGTGTTTCCT
AGATATTATCGCCAAGGTGGACGATTGTGGAAAGCGAAACAGTCCGAACACCTTTTCATGGCATCCGAGGACCAT
CCAGCCAAGTCACACTCTATCCGGAATTCACCTCTTCCTGGGATTTTGGGTTATCTGCCACTCCCAAGTATGGTA
TTAGGACTGCTTTGGAAGTGCCGAAATGTCTCTTACCAGCGTCTAAAGGTGCGAGGCCATATACGTGGCTTATTT
GACTTTAGATGTCTCGTTGGTCTCCTTGATATCGTCAGCGGAAGTCTTGCATTGTCGGCGGTAGGATACTTTGCA
TTCGTGGCGAACCCATGGTGGTTGACCAACTTCCTCGGTTTCTGCTTCTGCTATGGCACCCTGCAATTCATGTCT
CCCTCCACGTTCTGGACAGGAACGCTCATTATGGGATCCTTATTTTTCTATGATATCTACTTTGTCTTCTTCACA
CCGTTGATGGTCACTGTTGCAACCAAGTTGGATGTACCGATCAAGCTCCTGTTTCCCCGGCCGCCCACCTCTCGT
GATGCTCCTGGCTCTGTGCCGTTGGCCATGCTTGGACTGGGGGACATTGTCATTCCGGGAATGATGATTGGGCTG
TCACTACGCTTCGACCTATTCCTTTATTACCAGCGGAAAGGCGCTCAAATGGCACGTCTTGAAAGGTCGGACCAA
GCAACTGTCAAGCCTGAGTATCAGTCAGCAATCGGCGCTTGGGGAGAGCGGTTCTGGGCGCCACCAGTCAAGCCA
CTCCAGCCGGAACTTCAGCCTCCCTACTATGATGCACGGTGTTTTCCAAAGATCTACTTTAAAGCTAGCATAGCC
GGTTATGTTGTTGGAATGGTCACCACTCTCCTTGCCATGCAATATTCGAATCATGCTCAGCCAGCTCTTCTCTAT
TTGGTACCGGGTGTTTTGATATCGCTCTGGGGTACTGCGTTTATTCGAGGTGAGATTGACACAATGTGGGACTTC
TCTGATGCCGAGGAGGTGGACATTGAAGAGGAAAAGAAGGAAAATGAAGCCGAGGACAAGCCTTCTTCTCAAGAG
AAGAGCCTCTTTATGCGCATCTTCTCCGGTGACTACCTGCGTGCATCAAAAGACGAGAATGCAATGCGGGCTATG
AAAGTCAAAGAAGAGAACATTGATGACTCGAAATCTGAAACGAAATCATCGAAAGAAGGCGGGCGTAATGCCAAG
ACGAAGAAGCCCAAGAAGGACCGTGATAGCGCGGACCTGATCTCCTTCACCGTATCAATCCCTGGCAAGCCTAAA
CGTGAAATGCTGGTCAATTCGCCGACAACTTCCACAGAGGAAGAGGATGCAGAGGTGTCTGTTTCTAGGGATGCT
AATGGGGACAACGAACCGCCGTTGAAGAGAAGACGACGCAGCATGATGAATAAGAGTTCAGCAAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail