Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4415.t1
Gene name
Locationscaffold_09:199597..202192
Strand-
Gene length (bp)2595
Transcript length (bp)2349
Coding sequence length (bp)2349
Protein length (aa) 783

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 2.7E-22 518 757
PF01794 Ferric_reduct Ferric reductase like transmembrane component 6.5E-18 240 362
PF08022 FAD_binding_8 FAD-binding domain 8.7E-13 410 509

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 86 105 19
3 198 220 22
4 235 254 19
5 278 300 22
6 315 337 22
7 344 366 22
8 376 395 19
9 521 538 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 4.81 1.88 7.75
5d_25C Five days - 25 degrees Celsius 3.21 1.06 5.36
7d_25C Seven days - 25 degrees Celsius 4.85 1.87 7.84
10d_25C Ten days - 25 degrees Celsius 1.78 0.40 3.15
7d_15C Seven days - 15 degrees Celsius 6.23 2.65 9.80
7d_30C Seven days - 30 degrees Celsius 6.37 2.57 10.16

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.300794 no
3d_25C 7d_25C 0.987835 no
3d_25C 7d_15C 0.513578 no
3d_25C 7d_30C 0.482545 no
3d_25C 10d_25C 0.009770 yes
5d_25C 7d_25C 0.286918 no
5d_25C 7d_15C 0.053871 no
5d_25C 7d_30C 0.047696 yes
5d_25C 10d_25C 0.153493 no
7d_25C 7d_15C 0.525812 no
7d_25C 7d_30C 0.493016 no
7d_25C 10d_25C 0.009124 yes
7d_15C 7d_30C 0.967595 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4415.t1
MARRLCSRNWSAITDFDWFDYSIREEASYAWVIPKGRYHYRYRLRHFKMLSTIAKRINVAITASTTTAEAAEMQR
DPWSKSAKYGVGFVYFAVVLLIITTFVRCWHKWGDKMRIALYKENRPEIFRDDSVPDEYELPSAGTDASNAQFFP
SPTVVSPPKRHESILARIVPLNKAIALTRWIFYRPVPVLRVGNIELVLPSLAVTAIVLVAFVFVVLYCFVPQPLY
YWSIALGSPPLAIRAGMLAVAMIPWIVALSTKANFITMMTGLGPERLNGLHRWSAYICLFLSLVHMVPFYITPIW
EDGALVNYSIGIPPHAYVYGTGIAALVPLLVLCIHSLPVFRNWMYELFVFVHIPVSYIFVAMLFWHTRNYLSSWA
YLFTTLAIWVISYLVRLFYLNWTHPLRSSFLIGEEAAITLLPQNAIKITIPTKMRWRPGQYVYLRLPRISVIQSH
PFTIASLCSDDFPSAYGEKYRDMILVFRPFQGFTREVFQKALEHGPYKIYSAFVEGPYGGMQREMAAFDDVVFFA
GGSGITAIASQLLDLIKKIRDGKAITKSVKVIWALKNPEMMEWFQEELRICRDYAPSNIVSCHFFLTGVKQDDQI
GRDIVQEKIYGMLQGIDKRNSAYIRDEAAGNPDIEKELRRENEDGVAALPNAYMATHVPSTRQFYQPPMNLHSPA
ATNSGGTSNFDFRLGASQPVPPPVHAPRFAYYHARGRDNWRTDYFRPNITQMVNEFSKTFGRRACVFVCGPPSMR
VEVANTVAKLQMQVIMDSSKDEIFLHAENYNI*
Coding >Pro_DTO377G3_2|g4415.t1
ATGGCGAGACGCCTGTGCTCTAGAAATTGGTCTGCAATCACCGATTTCGATTGGTTCGACTATAGTATAAGAGAG
GAAGCCTCTTATGCGTGGGTGATACCTAAAGGAAGATATCACTATCGGTACCGACTAAGGCATTTCAAAATGCTG
AGCACTATTGCCAAGCGCATCAATGTTGCGATCACTGCATCGACGACTACAGCCGAGGCGGCTGAGATGCAGCGA
GATCCATGGTCAAAGTCAGCAAAATATGGAGTCGGATTTGTCTATTTCGCCGTCGTGCTACTGATAATCACAACT
TTCGTCCGATGCTGGCATAAATGGGGCGACAAGATGCGGATTGCCCTCTATAAAGAAAACCGACCAGAGATCTTC
CGCGACGACTCGGTACCGGACGAGTACGAGCTCCCGAGTGCAGGCACTGATGCTTCCAACGCCCAATTCTTTCCA
TCACCGACCGTAGTCTCTCCACCTAAGAGGCACGAATCTATTCTTGCAAGAATAGTTCCCTTGAACAAGGCAATT
GCTTTGACGCGATGGATCTTCTACCGACCAGTTCCCGTCCTGAGGGTTGGGAACATAGAGCTTGTTTTGCCGTCT
TTGGCGGTTACAGCGATTGTCTTGGTTGCATTTGTCTTCGTTGTTTTATACTGTTTCGTGCCACAGCCCTTATAC
TATTGGTCAATTGCGCTGGGGTCGCCACCGCTCGCTATCCGGGCAGGCATGCTTGCAGTAGCTATGATCCCCTGG
ATTGTTGCGCTCAGCACCAAGGCAAACTTTATCACTATGATGACTGGCCTAGGTCCTGAGCGGTTAAATGGACTG
CACCGCTGGTCAGCCTATATCTGCCTCTTCCTCAGTTTGGTTCATATGGTCCCGTTTTACATCACTCCAATCTGG
GAAGATGGTGCTTTGGTCAACTATAGCATAGGTATCCCACCACACGCCTATGTATATGGCACTGGAATTGCGGCG
CTGGTTCCTCTGCTTGTGTTGTGTATCCATTCTCTTCCAGTCTTTCGCAATTGGATGTATGAGCTTTTCGTCTTT
GTCCATATCCCAGTCTCGTACATCTTTGTGGCAATGCTCTTCTGGCACACGAGGAACTACCTGTCATCATGGGCC
TACCTTTTCACAACCCTTGCCATTTGGGTCATCTCATATCTCGTCCGGCTGTTCTATTTGAACTGGACACATCCT
TTGCGTTCGTCATTTTTGATCGGAGAAGAGGCAGCCATAACCCTTCTTCCGCAAAATGCTATAAAGATCACCATT
CCCACAAAGATGCGTTGGAGACCTGGTCAGTATGTCTACCTGCGACTACCAAGGATTTCCGTGATCCAGAGCCAC
CCTTTCACGATTGCCTCTCTTTGCAGCGACGACTTCCCATCTGCGTATGGTGAAAAGTATCGTGACATGATACTG
GTTTTCCGGCCATTCCAAGGTTTCACACGCGAGGTATTCCAGAAAGCCTTGGAACATGGCCCCTACAAAATATAC
AGCGCGTTTGTGGAAGGGCCATACGGTGGTATGCAGCGCGAGATGGCTGCTTTCGACGACGTGGTTTTCTTTGCC
GGAGGAAGTGGCATTACTGCCATTGCAAGCCAACTTCTGGACCTCATCAAGAAGATTCGAGATGGCAAGGCTATC
ACCAAATCGGTCAAAGTTATTTGGGCGCTCAAGAACCCCGAGATGATGGAGTGGTTCCAGGAGGAACTACGAATA
TGCCGTGACTACGCACCTTCTAACATTGTGAGCTGTCATTTCTTCCTCACCGGAGTGAAGCAAGACGACCAAATT
GGACGGGACATAGTACAGGAGAAGATTTACGGTATGCTTCAGGGTATTGATAAGCGGAACTCGGCTTATATACGC
GATGAAGCTGCCGGCAACCCTGATATAGAAAAGGAATTGCGCCGTGAGAATGAAGACGGTGTCGCTGCTCTTCCC
AATGCGTACATGGCAACCCATGTGCCCAGTACCCGTCAATTCTACCAGCCTCCCATGAACCTTCACAGCCCCGCA
GCAACAAATAGTGGTGGCACCTCAAATTTCGACTTCCGACTCGGCGCATCTCAACCTGTGCCGCCGCCAGTACAT
GCACCACGGTTTGCTTATTATCACGCACGTGGACGTGATAACTGGCGGACTGATTACTTCCGCCCGAACATCACG
CAGATGGTCAACGAGTTTTCCAAAACCTTCGGCCGTCGTGCGTGTGTTTTCGTCTGCGGTCCACCGAGCATGCGA
GTTGAAGTCGCCAACACGGTAGCCAAACTGCAGATGCAGGTGATTATGGACTCGTCGAAAGATGAGATATTTTTG
CATGCCGAGAACTATAATATCTAA
Transcript >Pro_DTO377G3_2|g4415.t1
ATGGCGAGACGCCTGTGCTCTAGAAATTGGTCTGCAATCACCGATTTCGATTGGTTCGACTATAGTATAAGAGAG
GAAGCCTCTTATGCGTGGGTGATACCTAAAGGAAGATATCACTATCGGTACCGACTAAGGCATTTCAAAATGCTG
AGCACTATTGCCAAGCGCATCAATGTTGCGATCACTGCATCGACGACTACAGCCGAGGCGGCTGAGATGCAGCGA
GATCCATGGTCAAAGTCAGCAAAATATGGAGTCGGATTTGTCTATTTCGCCGTCGTGCTACTGATAATCACAACT
TTCGTCCGATGCTGGCATAAATGGGGCGACAAGATGCGGATTGCCCTCTATAAAGAAAACCGACCAGAGATCTTC
CGCGACGACTCGGTACCGGACGAGTACGAGCTCCCGAGTGCAGGCACTGATGCTTCCAACGCCCAATTCTTTCCA
TCACCGACCGTAGTCTCTCCACCTAAGAGGCACGAATCTATTCTTGCAAGAATAGTTCCCTTGAACAAGGCAATT
GCTTTGACGCGATGGATCTTCTACCGACCAGTTCCCGTCCTGAGGGTTGGGAACATAGAGCTTGTTTTGCCGTCT
TTGGCGGTTACAGCGATTGTCTTGGTTGCATTTGTCTTCGTTGTTTTATACTGTTTCGTGCCACAGCCCTTATAC
TATTGGTCAATTGCGCTGGGGTCGCCACCGCTCGCTATCCGGGCAGGCATGCTTGCAGTAGCTATGATCCCCTGG
ATTGTTGCGCTCAGCACCAAGGCAAACTTTATCACTATGATGACTGGCCTAGGTCCTGAGCGGTTAAATGGACTG
CACCGCTGGTCAGCCTATATCTGCCTCTTCCTCAGTTTGGTTCATATGGTCCCGTTTTACATCACTCCAATCTGG
GAAGATGGTGCTTTGGTCAACTATAGCATAGGTATCCCACCACACGCCTATGTATATGGCACTGGAATTGCGGCG
CTGGTTCCTCTGCTTGTGTTGTGTATCCATTCTCTTCCAGTCTTTCGCAATTGGATGTATGAGCTTTTCGTCTTT
GTCCATATCCCAGTCTCGTACATCTTTGTGGCAATGCTCTTCTGGCACACGAGGAACTACCTGTCATCATGGGCC
TACCTTTTCACAACCCTTGCCATTTGGGTCATCTCATATCTCGTCCGGCTGTTCTATTTGAACTGGACACATCCT
TTGCGTTCGTCATTTTTGATCGGAGAAGAGGCAGCCATAACCCTTCTTCCGCAAAATGCTATAAAGATCACCATT
CCCACAAAGATGCGTTGGAGACCTGGTCAGTATGTCTACCTGCGACTACCAAGGATTTCCGTGATCCAGAGCCAC
CCTTTCACGATTGCCTCTCTTTGCAGCGACGACTTCCCATCTGCGTATGGTGAAAAGTATCGTGACATGATACTG
GTTTTCCGGCCATTCCAAGGTTTCACACGCGAGGTATTCCAGAAAGCCTTGGAACATGGCCCCTACAAAATATAC
AGCGCGTTTGTGGAAGGGCCATACGGTGGTATGCAGCGCGAGATGGCTGCTTTCGACGACGTGGTTTTCTTTGCC
GGAGGAAGTGGCATTACTGCCATTGCAAGCCAACTTCTGGACCTCATCAAGAAGATTCGAGATGGCAAGGCTATC
ACCAAATCGGTCAAAGTTATTTGGGCGCTCAAGAACCCCGAGATGATGGAGTGGTTCCAGGAGGAACTACGAATA
TGCCGTGACTACGCACCTTCTAACATTGTGAGCTGTCATTTCTTCCTCACCGGAGTGAAGCAAGACGACCAAATT
GGACGGGACATAGTACAGGAGAAGATTTACGGTATGCTTCAGGGTATTGATAAGCGGAACTCGGCTTATATACGC
GATGAAGCTGCCGGCAACCCTGATATAGAAAAGGAATTGCGCCGTGAGAATGAAGACGGTGTCGCTGCTCTTCCC
AATGCGTACATGGCAACCCATGTGCCCAGTACCCGTCAATTCTACCAGCCTCCCATGAACCTTCACAGCCCCGCA
GCAACAAATAGTGGTGGCACCTCAAATTTCGACTTCCGACTCGGCGCATCTCAACCTGTGCCGCCGCCAGTACAT
GCACCACGGTTTGCTTATTATCACGCACGTGGACGTGATAACTGGCGGACTGATTACTTCCGCCCGAACATCACG
CAGATGGTCAACGAGTTTTCCAAAACCTTCGGCCGTCGTGCGTGTGTTTTCGTCTGCGGTCCACCGAGCATGCGA
GTTGAAGTCGCCAACACGGTAGCCAAACTGCAGATGCAGGTGATTATGGACTCGTCGAAAGATGAGATATTTTTG
CATGCCGAGAACTATAATATCTAA
Gene >Pro_DTO377G3_2|g4415.t1
ATGGCGAGACGCCTGTGCTCTAGAAATTGGTCTGCAATCACCGATTTCGATTGGGTCAATGTCTGACCAGCCACA
ATATTCCGTTGTTGGGCTTAGGCTATCACAGTGCCGAGACTGCAAGCTTGTGTGACTCCCCGCTTCCTTTTTTCA
TACTTTAGACGGAATTTCCCTCGAAAACTCCCATTCCGTTGCCTTGACTTTGATGAAATCAATATTGATAGCTCT
ACTAAAGATATGAGCTCAGTTCGACTATAGTATAAGAGAGGAAGCCTCTTATGCGTGGGTGATACCTAAAGGTAG
GTTACCCCGTGCAAGACTTTTCTTGGGATGGATCTGACTAGAAAAATCTCAGGAAGATATCACTATCGGTACCGA
CTAAGGCATTTCAAAATGCTGAGCACTATTGCCAAGCGCATCAATGTTGCGATCACTGCATCGACGACTACAGCC
GAGGCGGCTGAGATGCAGCGAGATCCATGGTCAAAGTCAGCAAAATATGGAGTCGGATTTGTCTATTTCGCCGTC
GTGCTACTGATAATCACAACTTTCGTCCGATGCTGGCATAAATGGGGCGACAAGATGCGGATTGCCCTCTATAAA
GAAAACCGACCAGAGATCTTCCGCGACGACTCGGTACCGGACGAGTACGAGCTCCCGAGTGCAGGCACTGATGCT
TCCAACGCCCAATTCTTTCCATCACCGACCGTAGTCTCTCCACCTAAGAGGCACGAATCTATTCTTGCAAGAATA
GTTCCCTTGAACAAGGCAATTGCTTTGACGCGATGGATCTTCTACCGACCAGTTCCCGTCCTGAGGGTTGGGAAC
ATAGAGCTTGTTTTGCCGTCTTTGGCGGTTACAGCGATTGTCTTGGTTGCATTTGTCTTCGTTGTTTTATACTGT
TTCGTGCCACAGCCCTTATACTATTGGTCAATTGCGCTGGGGTCGCCACCGCTCGCTATCCGGGCAGGCATGCTT
GCAGTAGCTATGATCCCCTGGATTGTTGCGCTCAGCACCAAGGCAAACTTTATCACTATGATGACTGGCCTAGGT
CCTGAGCGGTTAAATGGACTGCACCGCTGGTCAGCCTATATCTGCCTCTTCCTCAGTTTGGTTCATATGGTCCCG
TTTTACATCACTCCAATCTGGGAAGATGGTGCTTTGGTCAACTATAGCATAGGTATCCCACCACACGCCTATGTA
TATGGCACTGGAATTGCGGCGCTGGTTCCTCTGCTTGTGTTGTGTATCCATTCTCTTCCAGTCTTTCGCAATTGG
ATGTATGAGCTTTTCGTCTTTGTCCATATCCCAGTCTCGTACATCTTTGTGGCAATGCTCTTCTGGCACACGAGG
AACTACCTGTCATCATGGGCCTACCTTTTCACAACCCTTGCCATTTGGGTCATCTCATATCTCGTCCGGCTGTTC
TATTTGAACTGGACACATCCTTTGCGTTCGTCATTTTTGATCGGAGAAGAGGCAGCCATAACCCTTCTTCCGCAA
AATGCTATAAAGATCACCATTCCCACAAAGATGCGTTGGAGACCTGGTCAGTATGTCTACCTGCGACTACCAAGG
ATTTCCGTGATCCAGAGCCACCCTTTCACGATTGCCTCTCTTTGCAGCGACGACTTCCCATCTGCGTATGGTGAA
AAGTATCGTGACATGATACTGGTTTTCCGGCCATTCCAAGGTTTCACACGCGAGGTATTCCAGAAAGCCTTGGAA
CATGGCCCCTACAAAATATACAGCGCGTTTGTGGAAGGGCCATACGGTGGTATGCAGCGCGAGATGGCTGCTTTC
GACGACGTGGTTTTCTTTGCCGGAGGAAGTGGCATTACTGCCATTGCAAGCCAACTTCTGGACCTCATCAAGAAG
ATTCGAGATGGCAAGGCTATCACCAAATCGGTCAAAGTTATTTGGGCGCTCAAGAACCCCGAGATGATGGAGTGG
TTCCAGGAGGAACTACGAATATGCCGTGACTACGCACCTTCTAACATTGTGAGCTGTCATTTCTTCCTCACCGGA
GTGAAGCAAGACGACCAAATTGGACGGGACATAGTACAGGAGAAGATTTACGGTATGCTTCAGGGTATTGATAAG
CGGAACTCGGCTTATATACGCGATGAAGCTGCCGGCAACCCTGATATAGAAAAGGAATTGCGCCGTGAGAATGAA
GACGGTGTCGCTGCTCTTCCCAATGCGTACATGGCAACCCATGTGCCCAGTACCCGTCAATTCTACCAGCCTCCC
ATGAACCTTCACAGCCCCGCAGCAACAAATAGTGGTGGCACCTCAAATTTCGACTTCCGACTCGGCGCATCTCAA
CCTGTGCCGCCGCCAGTACATGCACCACGGTTTGCTTATTATCACGCACGTGGACGTGATAACTGGCGGACTGAT
TACTTCCGCCCGAACATCACGCAGATGGTCAACGAGTTTTCCAAAACCTTCGGCCGTCGTGCGTGTGTTTTCGTC
TGCGGTCCACCGAGCATGCGAGTTGAAGTCGCCAACACGGTAGCCAAACTGCAGATGCAGGTGATTATGGACTCG
TCGAAAGATGAGATATTTTTGCATGCCGAGAACTATAATATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail