Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4411.t1
Gene name
Locationscaffold_09:192256..193939
Strand-
Gene length (bp)1683
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 6.1E-66 55 496

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0046914 transition metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 75.09 45.79 104.39
5d_25C Five days - 25 degrees Celsius 59.45 36.09 82.82
7d_25C Seven days - 25 degrees Celsius 44.47 26.26 62.69
10d_25C Ten days - 25 degrees Celsius 53.01 31.77 74.24
7d_15C Seven days - 15 degrees Celsius 52.35 31.35 73.34
7d_30C Seven days - 30 degrees Celsius 87.54 53.60 121.48

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.333742 no
3d_25C 7d_25C 0.010411 yes
3d_25C 7d_15C 0.105926 no
3d_25C 7d_30C 0.559331 no
3d_25C 10d_25C 0.115258 no
5d_25C 7d_25C 0.227800 no
5d_25C 7d_15C 0.651596 no
5d_25C 7d_30C 0.074414 no
5d_25C 10d_25C 0.693749 no
7d_25C 7d_15C 0.548542 no
7d_25C 7d_30C 0.001278 yes
7d_25C 10d_25C 0.510355 no
7d_15C 7d_30C 0.012904 yes
7d_15C 10d_25C 0.971799 no
7d_30C 10d_25C 0.012609 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4411.t1
MFVESVLGCFSLQRVLGGLVGLLAVATIAYTLYNRFIHPLRRINGPFLASITPWVQLYHGLKGDRHLWLHRLHSQ
YGTHVRVAPNFISVNSDRGLHDIYGHGKRLQKANFYNAFPAIKGVYNTHNAIDKTMHGRKRRVLSQAFSDNALKG
MEDVMLLHVRQLCAVLAGYDGDFESHDQKGNVKNMGDWFSYLSYDVMGELCFGKSFDMLISETRRYKVGLVDRAA
NRHYVCGLWMPLDTWGLDQIFIRKLTRDRWNFIMNSRVEANERAKERTQIGRDAKKDFFYYLLNAKDPETGNGLS
TPELWGESNVLMIAGSDTTSTTLAATLFYLVRRPDALAKLCAEVRGAFNEVEEIITSSQLGELVYLKACIDEALR
LAPAVPGAIPREVMQGGAVVDGVFLPAGTDCGTPTYSIHRQERYYREPGTFMPERWIENATCMGSGLSWQTTKES
IETARHAFCPFSIGPRGCIGKSMAFMEMRLTLARLVFLFDMSLADRQGEDAGGHLALTDHFTSAKNGPNVVFRRR
*
Coding >Pro_DTO377G3_2|g4411.t1
ATGTTTGTTGAATCGGTCTTGGGGTGCTTTTCTCTACAAAGAGTCCTAGGAGGCTTGGTAGGGCTATTAGCAGTA
GCGACCATCGCCTACACCCTCTACAATCGCTTCATCCACCCACTTCGCCGTATCAACGGCCCCTTCCTCGCATCT
ATCACACCCTGGGTCCAGCTCTACCATGGCCTGAAGGGCGACCGCCACCTCTGGCTGCACAGGCTGCACAGTCAG
TACGGGACACACGTACGAGTTGCGCCTAATTTCATCTCTGTCAACTCTGACCGTGGATTACACGATATCTATGGG
CACGGGAAACGCCTTCAGAAGGCCAATTTTTACAATGCTTTCCCTGCTATCAAGGGCGTGTATAACACGCACAAC
GCTATTGATAAAACCATGCACGGTCGCAAAAGGAGAGTTCTTAGCCAGGCCTTTTCTGATAATGCTCTGAAGGGG
ATGGAGGATGTGATGCTCCTCCATGTGCGTCAGCTGTGTGCTGTGCTTGCTGGGTATGACGGGGATTTCGAATCG
CATGATCAGAAGGGCAATGTCAAGAACATGGGTGATTGGTTTAGCTATCTCTCGTACGATGTCATGGGCGAGCTC
TGCTTTGGGAAGAGCTTTGACATGCTTATTTCTGAGACGAGGAGATATAAAGTTGGGTTGGTGGATCGTGCTGCG
AACAGGCATTATGTGTGTGGCCTTTGGATGCCCCTGGACACATGGGGTCTGGACCAGATATTCATCCGCAAGCTG
ACGCGCGATCGATGGAACTTCATTATGAATTCGCGTGTTGAAGCCAACGAGCGCGCTAAGGAGCGTACCCAGATT
GGTCGGGACGCCAAGAAGGATTTCTTTTATTACCTGTTGAACGCGAAGGACCCTGAGACCGGCAATGGACTTAGC
ACGCCCGAGCTTTGGGGCGAGTCCAACGTCCTCATGATTGCGGGCAGCGATACAACCTCGACTACACTGGCAGCC
ACACTCTTCTACTTAGTTCGTAGACCAGATGCATTGGCCAAGCTGTGTGCCGAGGTACGCGGCGCCTTTAACGAA
GTCGAAGAGATCATAACCAGCAGTCAGCTCGGCGAACTGGTGTATCTCAAAGCATGCATCGACGAGGCGTTGCGT
CTGGCCCCAGCGGTGCCCGGTGCGATTCCCCGCGAAGTGATGCAAGGTGGCGCCGTGGTCGACGGCGTGTTCTTA
CCCGCCGGTACGGACTGCGGCACACCAACATACTCCATCCACCGCCAAGAGCGATACTACCGGGAACCAGGGACC
TTCATGCCGGAGCGCTGGATTGAGAACGCCACCTGCATGGGCTCTGGATTGTCCTGGCAGACGACCAAGGAGAGC
ATTGAGACTGCGCGACACGCATTTTGTCCGTTTAGTATTGGGCCCCGTGGATGCATTGGCAAGAGCATGGCTTTT
ATGGAGATGCGGCTGACATTGGCGCGGCTGGTGTTCCTCTTTGACATGTCATTGGCCGATCGTCAGGGCGAAGAC
GCGGGGGGGCACCTGGCGCTGACCGATCATTTTACCTCGGCGAAGAATGGACCGAATGTTGTATTTCGACGGAGA
TAA
Transcript >Pro_DTO377G3_2|g4411.t1
ATGTTTGTTGAATCGGTCTTGGGGTGCTTTTCTCTACAAAGAGTCCTAGGAGGCTTGGTAGGGCTATTAGCAGTA
GCGACCATCGCCTACACCCTCTACAATCGCTTCATCCACCCACTTCGCCGTATCAACGGCCCCTTCCTCGCATCT
ATCACACCCTGGGTCCAGCTCTACCATGGCCTGAAGGGCGACCGCCACCTCTGGCTGCACAGGCTGCACAGTCAG
TACGGGACACACGTACGAGTTGCGCCTAATTTCATCTCTGTCAACTCTGACCGTGGATTACACGATATCTATGGG
CACGGGAAACGCCTTCAGAAGGCCAATTTTTACAATGCTTTCCCTGCTATCAAGGGCGTGTATAACACGCACAAC
GCTATTGATAAAACCATGCACGGTCGCAAAAGGAGAGTTCTTAGCCAGGCCTTTTCTGATAATGCTCTGAAGGGG
ATGGAGGATGTGATGCTCCTCCATGTGCGTCAGCTGTGTGCTGTGCTTGCTGGGTATGACGGGGATTTCGAATCG
CATGATCAGAAGGGCAATGTCAAGAACATGGGTGATTGGTTTAGCTATCTCTCGTACGATGTCATGGGCGAGCTC
TGCTTTGGGAAGAGCTTTGACATGCTTATTTCTGAGACGAGGAGATATAAAGTTGGGTTGGTGGATCGTGCTGCG
AACAGGCATTATGTGTGTGGCCTTTGGATGCCCCTGGACACATGGGGTCTGGACCAGATATTCATCCGCAAGCTG
ACGCGCGATCGATGGAACTTCATTATGAATTCGCGTGTTGAAGCCAACGAGCGCGCTAAGGAGCGTACCCAGATT
GGTCGGGACGCCAAGAAGGATTTCTTTTATTACCTGTTGAACGCGAAGGACCCTGAGACCGGCAATGGACTTAGC
ACGCCCGAGCTTTGGGGCGAGTCCAACGTCCTCATGATTGCGGGCAGCGATACAACCTCGACTACACTGGCAGCC
ACACTCTTCTACTTAGTTCGTAGACCAGATGCATTGGCCAAGCTGTGTGCCGAGGTACGCGGCGCCTTTAACGAA
GTCGAAGAGATCATAACCAGCAGTCAGCTCGGCGAACTGGTGTATCTCAAAGCATGCATCGACGAGGCGTTGCGT
CTGGCCCCAGCGGTGCCCGGTGCGATTCCCCGCGAAGTGATGCAAGGTGGCGCCGTGGTCGACGGCGTGTTCTTA
CCCGCCGGTACGGACTGCGGCACACCAACATACTCCATCCACCGCCAAGAGCGATACTACCGGGAACCAGGGACC
TTCATGCCGGAGCGCTGGATTGAGAACGCCACCTGCATGGGCTCTGGATTGTCCTGGCAGACGACCAAGGAGAGC
ATTGAGACTGCGCGACACGCATTTTGTCCGTTTAGTATTGGGCCCCGTGGATGCATTGGCAAGAGCATGGCTTTT
ATGGAGATGCGGCTGACATTGGCGCGGCTGGTGTTCCTCTTTGACATGTCATTGGCCGATCGTCAGGGCGAAGAC
GCGGGGGGGCACCTGGCGCTGACCGATCATTTTACCTCGGCGAAGAATGGACCGAATGTTGTATTTCGACGGAGA
TAA
Gene >Pro_DTO377G3_2|g4411.t1
ATGTTTGTTGAATCGGTCTTGGGGTGCTTTTCTCTACAAAGAGTCCTAGGAGGCTTGGTAGGGCTATTAGCAGTA
GCGGTACGTCCTATTCTTTTGATACCCCCAATCAACTTCTAATTGACTACAGACCATCGCCTACACCCTCTACAA
TCGCTTCATCCACCCACTTCGCCGTATCAACGGCCCCTTCCTCGCATCTATCACACCCTGGGTCCAGCTCTACCA
TGGCCTGAAGGGCGACCGCCACCTCTGGCTGCACAGGCTGCACAGTCAGTACGGGACACACGTACGAGTTGCGCC
TAATTTCATCTCTGTCAACTCTGACCGTGGATTACACGATATCTATGGGCACGGGAAACGCCTTCAGAAGGCCAA
TTTTTACAATGCTTTCCCTGCTATCAAGGGCGTGTATAACACGCACAACGCTATTGATAAAACCATGCACGGTCG
CAAAAGGAGAGTTCTTAGCCAGGCCTTTTCTGATAATGCTCTGAAGGGGATGGAGGATGTGATGCTCCTCCATGT
GCGTCAGCTGTGTGCTGTGCTTGCTGGGTATGACGGGGATTTCGAATCGCATGATCAGAAGGGCAATGTCAAGAA
CATGGGTGATTGGTTTAGCTATCTCTCGTACGATGTCATGGGCGAGCTCTGCTTTGGGAAGAGCTTTGACATGCT
TATTTCTGAGACGAGGAGATATAAAGTTGGGTTGGTGGATCGTGCTGCGAACAGGCATTATGTGGTAAGCATTTC
TTTTTTATCCATCGTCAAGGAACAATTCATCTGATTCTCTCATAGTGTGGCCTTTGGATGCCCCTGGACACATGG
GGTCTGGACCAGATATTCATCCGCAAGCTGACGCGCGATCGATGGAACTTCATTATGAATTCGCGTGTTGAAGCC
AACGAGCGCGCTAAGGAGCGTACCCAGATTGGTCGGGACGCCAAGAAGGATTTCTTTTATTACCTGTTGAACGCG
AAGGACCCTGAGACCGGCAATGGACTTAGCACGCCCGAGCTTTGGGGCGAGTCCAACGTCCTCATGATTGCGGGC
AGCGATACAACCTCGACTACACTGGCAGCCACACTCTTCTACTTAGTTCGTAGACCAGATGCATTGGCCAAGCTG
TGTGCCGAGGTACGCGGCGCCTTTAACGAAGTCGAAGAGATCATAACCAGCAGTCAGCTCGGCGAACTGGTGTAT
CTCAAAGCATGCATCGACGAGGCGTTGCGTCTGGCCCCAGCGGTGCCCGGTGCGATTCCCCGCGAAGTGATGCAA
GGTGGCGCCGTGGTCGACGGCGTGTTCTTACCCGCCGGTACGGACTGCGGCACACCAACATACTCCATCCACCGC
CAAGAGCGATACTACCGGGAACCAGGGACCTTCATGCCGGAGCGCTGGATTGAGAACGCCACCTGCATGGGCTCT
GGATTGTCCTGGCAGACGACCAAGGAGAGCATTGAGACTGCGCGACACGCATTTTGTCCGTTTAGTATTGGGCCC
CGTGGATGCATTGGCAAGAGCATGGCTTTTATGGAGATGCGGCTGACATTGGCGCGGCTGGTGTTCCTCTTTGAC
ATGTCATTGGCCGATCGTCAGGGCGAAGACGCGGGGGGGCACCTGGCGCTGACCGATCATTTTACCTCGGCGAAG
AATGGACCGAATGTTGTATTTCGACGGAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail