Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4387.t1
Gene name
Locationscaffold_09:127883..128735
Strand-
Gene length (bp)852
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01246 Ribosomal_L24e Ribosomal protein L24e 1.3E-27 1 66

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1293.79 772.29 1815.30
5d_25C Five days - 25 degrees Celsius 1133.83 677.10 1590.57
7d_25C Seven days - 25 degrees Celsius 1132.36 675.08 1589.63
10d_25C Ten days - 25 degrees Celsius 1317.24 784.43 1850.05
7d_15C Seven days - 15 degrees Celsius 1599.01 940.36 2257.67
7d_30C Seven days - 30 degrees Celsius 1132.71 680.90 1584.52

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.647867 no
3d_25C 7d_25C 0.638983 no
3d_25C 7d_15C 0.408826 no
3d_25C 7d_30C 0.631891 no
3d_25C 10d_25C 0.959911 no
5d_25C 7d_25C 0.997272 no
5d_25C 7d_15C 0.134928 no
5d_25C 7d_30C 0.997342 no
5d_25C 10d_25C 0.586445 no
7d_25C 7d_15C 0.135802 no
7d_25C 7d_30C 0.998976 no
7d_25C 10d_25C 0.583725 no
7d_15C 7d_30C 0.122548 no
7d_15C 10d_25C 0.453635 no
7d_30C 10d_25C 0.574467 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4387.t1
MRTYDDAFSGQKIYPGKGKLFVRGDSKIFRFQRGKSESLFLQRKNPRRIAWTVLFRRQHRKGISEEVAKKRTRRV
VKNQRGIVGASLDVIKERRSQRPEAREAARKQAIKDAKEKKAASASAKKAEKAKIAASKGGAQRIQSKQGAKGSA
PKVAAKSR*
Coding >Pro_DTO377G3_2|g4387.t1
ATGCGTACTTACGACGACGCCTTCAGCGGCCAGAAGATCTACCCTGGCAAGGGCAAGCTATTCGTCCGTGGCGAC
AGCAAGATCTTCCGCTTCCAGCGTGGAAAGTCCGAGTCCCTTTTCCTTCAGCGCAAGAACCCCCGCCGCATCGCA
TGGACTGTTCTCTTCCGTCGCCAGCACCGCAAGGGTATCTCTGAGGAGGTCGCCAAGAAGCGCACCCGCCGTGTT
GTCAAGAACCAGCGTGGCATCGTCGGTGCTTCCCTCGATGTGATTAAGGAGCGCCGCTCCCAACGCCCCGAGGCT
CGTGAGGCTGCTCGCAAGCAGGCCATCAAGGACGCCAAGGAGAAGAAGGCTGCTTCCGCCAGCGCCAAGAAGGCC
GAGAAGGCTAAGATCGCCGCCTCTAAGGGCGGTGCCCAGCGCATCCAGAGCAAGCAGGGTGCTAAGGGCTCTGCT
CCCAAGGTCGCCGCCAAGTCCCGCTAA
Transcript >Pro_DTO377G3_2|g4387.t1
ATGCGTACTTACGACGACGCCTTCAGCGGCCAGAAGATCTACCCTGGCAAGGGCAAGCTATTCGTCCGTGGCGAC
AGCAAGATCTTCCGCTTCCAGCGTGGAAAGTCCGAGTCCCTTTTCCTTCAGCGCAAGAACCCCCGCCGCATCGCA
TGGACTGTTCTCTTCCGTCGCCAGCACCGCAAGGGTATCTCTGAGGAGGTCGCCAAGAAGCGCACCCGCCGTGTT
GTCAAGAACCAGCGTGGCATCGTCGGTGCTTCCCTCGATGTGATTAAGGAGCGCCGCTCCCAACGCCCCGAGGCT
CGTGAGGCTGCTCGCAAGCAGGCCATCAAGGACGCCAAGGAGAAGAAGGCTGCTTCCGCCAGCGCCAAGAAGGCC
GAGAAGGCTAAGATCGCCGCCTCTAAGGGCGGTGCCCAGCGCATCCAGAGCAAGCAGGGTGCTAAGGGCTCTGCT
CCCAAGGTCGCCGCCAAGTCCCGCTAA
Gene >Pro_DTO377G3_2|g4387.t1
ATGCGTACTTACGACGACGCCTTCAGCGGCCAGAAGATCTACCCTGGCAAGGTGCGTTTGCAAATCCCGTCGTCG
CTTTTGGGGGGGGGAATTCTTGTGCGAGGGAACAACGGCATCACGGATTCGACATTCACTCTTCGACGTCAAAAC
TGTCGCTCTCCATCTTGCCGAACTACCGCACATGAATTTTGCCGTTTTCTTATTGCCGCTAGAAGCTAATCTTTG
ATGTTCAATGTTTAGGGCAAGCTATTCGTCCGTGGCGACAGCAAGATCTTCCGCTTCCAGCGTGGAAAGTCCGAG
TCCCTTTTCCTTCAGCGCAAGAACCCCCGCCGCATCGCATGGACTGTTCTCTTCCGTCGCCAGCACCGCAAGGGT
ATCTCTGAGGTCGGTCGCCCCTCTCCTTGGATTATTGTTAGATTGTGTGGAGGGACAAAGGCCGAATTGAATGGT
GACGCACAAACCATGAAACGGAGCAAGAGCAGGAATTATCACGTCACCACCATTATTCGGATCAAATGATGGAGA
ATGCGACTGCAGATTGCTGACCGGGTTATCTTTTTGGATATATAGGAGGTCGCCAAGAAGCGCACCCGCCGTGTT
GTCAAGAACCAGCGTGGCATCGTCGGTGCTTCCCTCGATGTGATTAAGGAGCGCCGCTCCCAACGCCCCGAGGCT
CGTGAGGCTGCTCGCAAGCAGGCCATCAAGGACGCCAAGGAGAAGAAGGCTGCTTCCGCCAGCGCCAAGAAGGCC
GAGAAGGCTAAGATCGCCGCCTCTAAGGGCGGTGCCCAGCGCATCCAGAGCAAGCAGGGTGCTAAGGGCTCTGCT
CCCAAGGTCGCCGCCAAGTCCCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail