Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4366.t1
Gene name
Locationscaffold_09:73616..79041
Strand-
Gene length (bp)5425
Transcript length (bp)5256
Coding sequence length (bp)5256
Protein length (aa) 1752

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08354 DUF1729 Domain of unknown function (DUF1729) 1.2E-138 732 1060
PF17951 FAS_meander Fatty acid synthase meander beta sheet domain 3.2E-41 1121 1263
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 2.3E-35 164 417
PF01575 MaoC_dehydratas MaoC like domain 4.8E-25 1527 1640
PF00698 Acyl_transf_1 Acyl transferase domain 2.5E-17 1662 1713
PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase 9.4E-12 1277 1395

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity Yes
GO:0008150 biological_process No
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor No
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016746 transferase activity, transferring acyl groups No
GO:0004312 fatty acid synthase activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4366.t1
MLISTELPGPSAVLSASTSSNWSTPDELSTSSSPSNIWGSQILTITDGRFTHTLSISTASFPAALQLRDDFLHDL
QTAEQSPHGLADDLRHLLTIALDTFDRDILLQREIHGVVYALDISADAESAILAAYVRARHVLRKVSRPAAPSAL
LAAAQQRKARLYAVFGGQGNDEDYFEELRMLWQTYRPLVEDLIPSVSSMLQRETREESISRFYHNGMDIVTWLEN
PDRTPPSDYLIGASISMPLIGLLQLAWYRVVGRIVGTTPAQLQTALAGATGHSQGIIPATVIVVAQSWTQFDALA
LDALRLLLAIGTASQDQFAVGQLPPAVVADAEANGEGFPGPMLSVADCPISQLRTYVASVNGYLPVDARIEIALI
NGPTNAVLAGPPLSLHGFNVWLRQVKAPAKGLQHRIPFSQRKPEIHTRFLPITTAFHSSYLTDVAPGVLERVADF
TITGDQLRIPVFCTHTGTDLRKCGAVNLIPKLIAMITTQQVVWPRAVHFPGSTHILAFGPDGASGIGTLTNRLKE
GTGVRTILATGISSSRTELGDRSEFFNWNPAPKGLVYGPIWRNRYRPQLVQIAGGGVLVDTKLSRLLGLPPVMVA
GMTPTTAAWDFCAAVMRAGYHVELALGGFHQAAQLETDVYKLLDAVPAGRGITCNMIYAAPHAVKWQIPLLAKLR
AAGVPLEGLTIGAGVPSLEVATRYINELGLRHMGFKPGTLPAIYQVLDIASAHPTFPILLQWTGGRGGGHHSFED
FHQPILQAYDSIRRCENVILVAGSGFGGAQDTFPYLTGDWACRYNRPPMPFDGILLGSRLMTAKEAHTSPAVKQA
IVNAPGVEDEGDWEQTYTQPAGGIMTVTSEMGEPIHKLATRGVQLWAELDRNVFSLDRSKRVAYLQKHRDYLIQR
LNTDSVKVWFGCDVQGSVIDLEEMTYAEVLRRFIALTYVSAEGRWIDDSYRLFLQDFLKRVDARIGDVAPGPGLS
EVNGDEALADPTTALNAILKRLPTAEAQLIGTQDAEYFLLLCQRRGTKPVPFVPVLDENFETYFKKDSLWQSEDL
AAVADADVGRQQDPEYQQDGIPIVDCFSPYSVPQDWRLAELGIHCSPVGNTGAMLYEVKPLDGAPGAPPTPSLAE
WLVALGGSNGGWRQAFFHAATIVQGRAICENPLRRLFQPTRESYVMVQQGHGGLSADPIITLFEHRPHSEPVKVV
EVRVDEPSVITLEIINYRNAGGAAIGLQLKFQFRREAVYAPIHEIMEGRNQRVKDFYYRVWFAGEPPETWPSVHD
TFRESQFEVTADSIAEFAHCVQNASDAASKRRGKRMAAPLDFGVVIGWEALMKPLFSRELDVDLLTLVHLTNGFR
IPADADPIQAGYALETKSRIQAITIEETGKLVEVRADVYHENKVVLELSSQFLYRGHHTDWENMFRKVDEEEMEL
CPRSPMEVAILNSKSWFQPLDRSLDLENQTLVFVLRSTYQYASKDTFKTVTTVGEVRVNSSLPGGSRPIATVDYH
AVTCRGSPVMDYLKRHGSPVQKRAMFDQPSPLTNDGESLILTMPHSNEAYAHVSWDFNPIHVSASLSRYADLPGL
ITHSMYTSARVRGLVEHYTCASTIGAFRSFHCSFTSMVLPGDKIEVVFQHIGMLAGRKIVSVEAKHVGRGETVLR
GEAEIEPEETAFLFTGQGSQQKGMGMQLYTQSKAAQQVWDYADAYFSDNYGFRITDIVRNDPKELTVYFGGPQGR
HIRDQYRSMTRESIGPLSRRNSRQWS*
Coding >Pro_DTO377G3_2|g4366.t1
ATGTTGATCTCGACCGAATTGCCGGGGCCGTCGGCTGTCTTGTCGGCTTCGACTTCCTCGAACTGGTCAACGCCT
GATGAACTATCCACCTCGTCGTCGCCCAGCAACATTTGGGGCAGCCAAATCCTCACCATCACAGATGGCCGTTTC
ACACATACCCTCTCCATTTCTACTGCCTCATTCCCCGCTGCGCTTCAGCTGCGCGATGACTTTCTCCATGATCTT
CAAACCGCTGAGCAATCTCCTCATGGATTGGCTGACGATCTCCGACATCTTTTGACCATCGCCCTCGATACCTTC
GATCGTGATATTCTACTGCAGCGCGAGATCCATGGTGTAGTCTATGCCTTGGACATCTCCGCAGACGCCGAGTCG
GCCATTTTAGCTGCTTACGTACGTGCGCGCCATGTTCTGCGCAAAGTCAGTCGACCAGCGGCACCTTCTGCGCTC
CTGGCTGCCGCGCAGCAACGCAAAGCACGACTATATGCTGTGTTCGGCGGGCAGGGCAATGATGAAGATTACTTT
GAAGAGCTGCGGATGCTCTGGCAGACCTATCGCCCGCTGGTGGAAGACCTCATTCCGTCAGTCTCGAGTATGCTG
CAGCGCGAGACCCGTGAGGAGAGCATTAGTCGATTCTATCACAACGGCATGGACATAGTCACCTGGCTCGAGAAC
CCGGATCGTACGCCACCATCTGACTACCTAATCGGTGCGTCTATCAGTATGCCGCTCATCGGTTTGTTGCAGCTG
GCCTGGTATCGAGTCGTCGGACGCATAGTGGGTACCACACCTGCCCAGCTTCAGACCGCGCTTGCTGGAGCCACG
GGACATTCTCAAGGCATCATCCCAGCCACTGTGATTGTAGTGGCACAATCATGGACGCAATTCGACGCGCTCGCG
CTCGATGCGCTTCGGTTGCTGCTCGCCATCGGAACTGCCAGCCAGGACCAATTTGCCGTGGGCCAGCTGCCGCCG
GCTGTTGTCGCAGACGCCGAAGCCAACGGCGAGGGCTTTCCAGGACCCATGCTGAGTGTGGCAGACTGTCCAATC
TCCCAGCTCCGCACCTATGTAGCTTCCGTCAATGGGTATTTGCCCGTTGATGCCCGCATTGAGATAGCTCTAATC
AACGGGCCTACCAATGCCGTTTTGGCTGGACCGCCACTGTCACTTCATGGGTTTAATGTTTGGCTACGACAGGTG
AAAGCTCCGGCAAAGGGCTTGCAACATCGGATTCCTTTCAGCCAGCGAAAGCCTGAGATCCATACCAGATTCCTT
CCAATAACCACGGCCTTCCACAGCAGCTATCTAACAGATGTCGCTCCGGGCGTGCTGGAGCGTGTCGCGGATTTC
ACCATAACCGGTGACCAACTCCGAATCCCTGTCTTTTGCACCCACACAGGGACAGATCTACGCAAGTGTGGAGCC
GTCAACTTGATTCCCAAGCTCATTGCGATGATAACGACCCAGCAAGTCGTCTGGCCACGGGCCGTGCATTTTCCC
GGATCCACGCATATTCTTGCTTTTGGGCCTGATGGTGCATCTGGCATTGGAACTCTCACTAATCGACTCAAGGAG
GGTACTGGCGTCCGTACTATCCTGGCCACGGGCATCTCCAGCTCCCGCACCGAGCTGGGAGATCGCAGTGAGTTC
TTTAACTGGAATCCTGCGCCCAAGGGTCTCGTCTACGGACCTATATGGCGGAATCGCTACCGACCGCAGTTGGTA
CAGATTGCCGGCGGCGGCGTGCTTGTCGATACTAAGCTCAGTCGCCTCTTGGGCTTGCCACCAGTCATGGTGGCC
GGAATGACGCCCACAACTGCAGCCTGGGATTTCTGTGCGGCAGTTATGCGCGCCGGCTATCATGTCGAATTGGCA
CTGGGCGGATTCCATCAAGCCGCCCAGTTGGAGACAGACGTTTACAAGCTGCTGGACGCGGTACCTGCTGGCCGG
GGCATCACCTGCAACATGATCTACGCCGCTCCTCACGCGGTGAAGTGGCAGATTCCGCTGCTGGCCAAATTACGC
GCGGCCGGCGTTCCCCTGGAGGGACTCACTATCGGCGCAGGCGTGCCTTCACTCGAGGTGGCCACTCGGTACATC
AACGAGCTCGGTCTACGCCACATGGGCTTCAAGCCTGGCACTTTACCCGCGATATACCAAGTCCTCGACATCGCA
TCGGCTCATCCCACCTTCCCTATTCTACTCCAATGGACAGGTGGGCGAGGTGGTGGCCACCACTCATTCGAGGAC
TTCCACCAACCGATCTTGCAAGCCTACGACTCCATCCGCCGCTGCGAGAACGTTATTCTTGTAGCGGGCAGTGGC
TTTGGCGGTGCACAGGACACATTCCCCTACCTAACAGGTGATTGGGCCTGTCGGTATAACCGCCCGCCCATGCCC
TTCGATGGTATCCTTCTCGGCAGTCGTTTGATGACCGCCAAAGAAGCGCATACCAGCCCAGCTGTGAAACAGGCA
ATTGTGAATGCGCCAGGAGTCGAGGATGAAGGTGATTGGGAGCAGACATACACACAACCAGCTGGCGGCATTATG
ACTGTAACCTCAGAGATGGGGGAACCTATTCATAAGCTGGCTACGCGGGGTGTGCAACTATGGGCTGAGTTAGAT
CGCAATGTCTTCAGCCTTGATCGTAGTAAGCGCGTCGCGTATCTGCAGAAACACCGTGACTACCTGATTCAGCGA
CTGAATACCGATTCGGTGAAGGTCTGGTTTGGGTGCGATGTCCAGGGATCTGTTATCGACTTGGAGGAGATGACT
TACGCCGAGGTTCTGCGCCGTTTTATTGCGCTTACCTATGTGTCGGCTGAGGGCCGCTGGATCGATGATTCCTAC
CGCTTGTTCCTGCAAGATTTCCTAAAGCGCGTGGATGCCCGCATTGGCGACGTAGCCCCCGGCCCCGGACTCAGC
GAAGTCAACGGCGACGAGGCTCTTGCTGATCCGACAACAGCGCTGAACGCCATCTTGAAGCGGTTGCCGACCGCT
GAGGCCCAGCTTATTGGCACGCAAGATGCGGAATACTTTTTGCTTCTATGCCAGAGACGCGGCACAAAGCCAGTA
CCGTTTGTCCCTGTCCTCGACGAAAACTTCGAGACTTACTTCAAAAAAGACTCGCTGTGGCAGTCAGAGGATCTT
GCAGCTGTTGCTGACGCTGATGTCGGCCGGCAGCAAGATCCCGAATACCAGCAGGATGGTATCCCTATTGTCGAC
TGCTTCAGCCCATACTCTGTCCCACAGGACTGGCGACTTGCGGAGCTGGGCATTCATTGCTCGCCCGTCGGAAAC
ACAGGCGCGATGTTATATGAAGTGAAACCACTGGACGGTGCGCCCGGTGCGCCACCAACACCCTCGTTAGCAGAA
TGGCTTGTGGCCTTGGGCGGTTCCAATGGAGGCTGGCGCCAAGCATTCTTCCACGCAGCGACGATCGTGCAGGGC
CGAGCCATCTGCGAGAATCCGCTGCGGCGGCTTTTCCAGCCCACGCGTGAATCATACGTGATGGTGCAGCAGGGC
CACGGAGGCCTTTCGGCAGATCCGATAATCACGCTGTTCGAACATCGGCCACACTCTGAGCCGGTCAAGGTCGTG
GAGGTGCGAGTGGATGAGCCTAGCGTTATCACGCTTGAGATCATCAACTACCGTAATGCTGGAGGTGCCGCTATT
GGGCTGCAGTTGAAGTTCCAGTTCAGGCGTGAGGCTGTTTACGCTCCCATCCATGAAATTATGGAAGGCCGCAAC
CAGCGTGTCAAAGACTTCTACTATAGAGTCTGGTTCGCGGGTGAACCACCAGAGACATGGCCCTCGGTCCACGAC
ACCTTCCGCGAATCGCAGTTTGAGGTGACGGCCGACTCAATCGCCGAGTTCGCCCATTGTGTACAGAATGCCAGC
GATGCCGCTAGCAAGCGGCGTGGCAAACGGATGGCGGCACCGTTGGACTTTGGTGTCGTCATTGGCTGGGAAGCT
TTGATGAAGCCGCTTTTCTCGCGGGAGCTTGACGTCGATCTGTTGACGCTGGTGCATCTCACCAATGGCTTCCGC
ATTCCCGCAGATGCGGACCCCATTCAGGCAGGTTATGCACTTGAGACCAAGTCTCGTATACAAGCCATTACGATC
GAGGAGACAGGTAAATTGGTCGAGGTACGTGCGGATGTGTACCATGAGAATAAGGTCGTGCTCGAGTTAAGCAGT
CAATTCCTCTACCGAGGCCACCACACAGACTGGGAGAATATGTTCCGCAAAGTGGACGAGGAAGAGATGGAGCTC
TGCCCCCGTAGCCCGATGGAGGTTGCGATCTTGAACTCGAAGTCCTGGTTCCAGCCCCTGGATCGGTCGCTCGAC
CTGGAAAACCAGACTTTGGTCTTCGTACTTCGTTCGACCTACCAATACGCCAGCAAGGACACCTTCAAGACCGTT
ACTACTGTTGGTGAAGTTCGCGTGAATTCATCGCTCCCAGGTGGTTCGCGGCCGATTGCGACCGTAGACTATCAC
GCAGTCACCTGCCGAGGTAGCCCTGTCATGGATTACCTCAAGCGTCATGGTAGTCCAGTGCAGAAGCGCGCTATG
TTTGATCAGCCTAGTCCCTTGACTAACGATGGCGAATCTTTGATTCTCACTATGCCACACTCTAACGAGGCTTAT
GCTCACGTCTCCTGGGACTTCAATCCCATCCATGTGTCCGCGTCGCTGTCGCGATATGCAGATCTACCAGGTCTG
ATCACGCACAGCATGTACACCTCGGCACGGGTACGTGGACTTGTCGAACACTACACCTGTGCCTCAACCATCGGC
GCCTTCCGTAGCTTCCACTGCTCATTCACGAGTATGGTGCTACCGGGAGATAAGATTGAAGTCGTCTTCCAGCAC
ATCGGCATGTTGGCGGGACGCAAGATCGTCTCAGTGGAGGCAAAGCACGTCGGGCGCGGCGAGACCGTTCTGCGT
GGAGAAGCTGAGATCGAACCTGAGGAGACGGCATTCCTTTTCACTGGTCAGGGTAGTCAACAAAAGGGCATGGGT
ATGCAGCTCTATACCCAAAGCAAAGCGGCACAGCAGGTCTGGGATTATGCTGATGCCTACTTCTCCGATAACTAT
GGCTTCCGCATTACCGACATCGTGCGGAATGATCCCAAGGAGTTGACCGTCTACTTCGGAGGGCCTCAAGGCCGA
CACATCCGTGACCAATATCGTAGTATGACGCGAGAGTCCATTGGGCCCCTTTCGCGCCGAAACTCGCGCCAATGG
TCATAA
Transcript >Pro_DTO377G3_2|g4366.t1
ATGTTGATCTCGACCGAATTGCCGGGGCCGTCGGCTGTCTTGTCGGCTTCGACTTCCTCGAACTGGTCAACGCCT
GATGAACTATCCACCTCGTCGTCGCCCAGCAACATTTGGGGCAGCCAAATCCTCACCATCACAGATGGCCGTTTC
ACACATACCCTCTCCATTTCTACTGCCTCATTCCCCGCTGCGCTTCAGCTGCGCGATGACTTTCTCCATGATCTT
CAAACCGCTGAGCAATCTCCTCATGGATTGGCTGACGATCTCCGACATCTTTTGACCATCGCCCTCGATACCTTC
GATCGTGATATTCTACTGCAGCGCGAGATCCATGGTGTAGTCTATGCCTTGGACATCTCCGCAGACGCCGAGTCG
GCCATTTTAGCTGCTTACGTACGTGCGCGCCATGTTCTGCGCAAAGTCAGTCGACCAGCGGCACCTTCTGCGCTC
CTGGCTGCCGCGCAGCAACGCAAAGCACGACTATATGCTGTGTTCGGCGGGCAGGGCAATGATGAAGATTACTTT
GAAGAGCTGCGGATGCTCTGGCAGACCTATCGCCCGCTGGTGGAAGACCTCATTCCGTCAGTCTCGAGTATGCTG
CAGCGCGAGACCCGTGAGGAGAGCATTAGTCGATTCTATCACAACGGCATGGACATAGTCACCTGGCTCGAGAAC
CCGGATCGTACGCCACCATCTGACTACCTAATCGGTGCGTCTATCAGTATGCCGCTCATCGGTTTGTTGCAGCTG
GCCTGGTATCGAGTCGTCGGACGCATAGTGGGTACCACACCTGCCCAGCTTCAGACCGCGCTTGCTGGAGCCACG
GGACATTCTCAAGGCATCATCCCAGCCACTGTGATTGTAGTGGCACAATCATGGACGCAATTCGACGCGCTCGCG
CTCGATGCGCTTCGGTTGCTGCTCGCCATCGGAACTGCCAGCCAGGACCAATTTGCCGTGGGCCAGCTGCCGCCG
GCTGTTGTCGCAGACGCCGAAGCCAACGGCGAGGGCTTTCCAGGACCCATGCTGAGTGTGGCAGACTGTCCAATC
TCCCAGCTCCGCACCTATGTAGCTTCCGTCAATGGGTATTTGCCCGTTGATGCCCGCATTGAGATAGCTCTAATC
AACGGGCCTACCAATGCCGTTTTGGCTGGACCGCCACTGTCACTTCATGGGTTTAATGTTTGGCTACGACAGGTG
AAAGCTCCGGCAAAGGGCTTGCAACATCGGATTCCTTTCAGCCAGCGAAAGCCTGAGATCCATACCAGATTCCTT
CCAATAACCACGGCCTTCCACAGCAGCTATCTAACAGATGTCGCTCCGGGCGTGCTGGAGCGTGTCGCGGATTTC
ACCATAACCGGTGACCAACTCCGAATCCCTGTCTTTTGCACCCACACAGGGACAGATCTACGCAAGTGTGGAGCC
GTCAACTTGATTCCCAAGCTCATTGCGATGATAACGACCCAGCAAGTCGTCTGGCCACGGGCCGTGCATTTTCCC
GGATCCACGCATATTCTTGCTTTTGGGCCTGATGGTGCATCTGGCATTGGAACTCTCACTAATCGACTCAAGGAG
GGTACTGGCGTCCGTACTATCCTGGCCACGGGCATCTCCAGCTCCCGCACCGAGCTGGGAGATCGCAGTGAGTTC
TTTAACTGGAATCCTGCGCCCAAGGGTCTCGTCTACGGACCTATATGGCGGAATCGCTACCGACCGCAGTTGGTA
CAGATTGCCGGCGGCGGCGTGCTTGTCGATACTAAGCTCAGTCGCCTCTTGGGCTTGCCACCAGTCATGGTGGCC
GGAATGACGCCCACAACTGCAGCCTGGGATTTCTGTGCGGCAGTTATGCGCGCCGGCTATCATGTCGAATTGGCA
CTGGGCGGATTCCATCAAGCCGCCCAGTTGGAGACAGACGTTTACAAGCTGCTGGACGCGGTACCTGCTGGCCGG
GGCATCACCTGCAACATGATCTACGCCGCTCCTCACGCGGTGAAGTGGCAGATTCCGCTGCTGGCCAAATTACGC
GCGGCCGGCGTTCCCCTGGAGGGACTCACTATCGGCGCAGGCGTGCCTTCACTCGAGGTGGCCACTCGGTACATC
AACGAGCTCGGTCTACGCCACATGGGCTTCAAGCCTGGCACTTTACCCGCGATATACCAAGTCCTCGACATCGCA
TCGGCTCATCCCACCTTCCCTATTCTACTCCAATGGACAGGTGGGCGAGGTGGTGGCCACCACTCATTCGAGGAC
TTCCACCAACCGATCTTGCAAGCCTACGACTCCATCCGCCGCTGCGAGAACGTTATTCTTGTAGCGGGCAGTGGC
TTTGGCGGTGCACAGGACACATTCCCCTACCTAACAGGTGATTGGGCCTGTCGGTATAACCGCCCGCCCATGCCC
TTCGATGGTATCCTTCTCGGCAGTCGTTTGATGACCGCCAAAGAAGCGCATACCAGCCCAGCTGTGAAACAGGCA
ATTGTGAATGCGCCAGGAGTCGAGGATGAAGGTGATTGGGAGCAGACATACACACAACCAGCTGGCGGCATTATG
ACTGTAACCTCAGAGATGGGGGAACCTATTCATAAGCTGGCTACGCGGGGTGTGCAACTATGGGCTGAGTTAGAT
CGCAATGTCTTCAGCCTTGATCGTAGTAAGCGCGTCGCGTATCTGCAGAAACACCGTGACTACCTGATTCAGCGA
CTGAATACCGATTCGGTGAAGGTCTGGTTTGGGTGCGATGTCCAGGGATCTGTTATCGACTTGGAGGAGATGACT
TACGCCGAGGTTCTGCGCCGTTTTATTGCGCTTACCTATGTGTCGGCTGAGGGCCGCTGGATCGATGATTCCTAC
CGCTTGTTCCTGCAAGATTTCCTAAAGCGCGTGGATGCCCGCATTGGCGACGTAGCCCCCGGCCCCGGACTCAGC
GAAGTCAACGGCGACGAGGCTCTTGCTGATCCGACAACAGCGCTGAACGCCATCTTGAAGCGGTTGCCGACCGCT
GAGGCCCAGCTTATTGGCACGCAAGATGCGGAATACTTTTTGCTTCTATGCCAGAGACGCGGCACAAAGCCAGTA
CCGTTTGTCCCTGTCCTCGACGAAAACTTCGAGACTTACTTCAAAAAAGACTCGCTGTGGCAGTCAGAGGATCTT
GCAGCTGTTGCTGACGCTGATGTCGGCCGGCAGCAAGATCCCGAATACCAGCAGGATGGTATCCCTATTGTCGAC
TGCTTCAGCCCATACTCTGTCCCACAGGACTGGCGACTTGCGGAGCTGGGCATTCATTGCTCGCCCGTCGGAAAC
ACAGGCGCGATGTTATATGAAGTGAAACCACTGGACGGTGCGCCCGGTGCGCCACCAACACCCTCGTTAGCAGAA
TGGCTTGTGGCCTTGGGCGGTTCCAATGGAGGCTGGCGCCAAGCATTCTTCCACGCAGCGACGATCGTGCAGGGC
CGAGCCATCTGCGAGAATCCGCTGCGGCGGCTTTTCCAGCCCACGCGTGAATCATACGTGATGGTGCAGCAGGGC
CACGGAGGCCTTTCGGCAGATCCGATAATCACGCTGTTCGAACATCGGCCACACTCTGAGCCGGTCAAGGTCGTG
GAGGTGCGAGTGGATGAGCCTAGCGTTATCACGCTTGAGATCATCAACTACCGTAATGCTGGAGGTGCCGCTATT
GGGCTGCAGTTGAAGTTCCAGTTCAGGCGTGAGGCTGTTTACGCTCCCATCCATGAAATTATGGAAGGCCGCAAC
CAGCGTGTCAAAGACTTCTACTATAGAGTCTGGTTCGCGGGTGAACCACCAGAGACATGGCCCTCGGTCCACGAC
ACCTTCCGCGAATCGCAGTTTGAGGTGACGGCCGACTCAATCGCCGAGTTCGCCCATTGTGTACAGAATGCCAGC
GATGCCGCTAGCAAGCGGCGTGGCAAACGGATGGCGGCACCGTTGGACTTTGGTGTCGTCATTGGCTGGGAAGCT
TTGATGAAGCCGCTTTTCTCGCGGGAGCTTGACGTCGATCTGTTGACGCTGGTGCATCTCACCAATGGCTTCCGC
ATTCCCGCAGATGCGGACCCCATTCAGGCAGGTTATGCACTTGAGACCAAGTCTCGTATACAAGCCATTACGATC
GAGGAGACAGGTAAATTGGTCGAGGTACGTGCGGATGTGTACCATGAGAATAAGGTCGTGCTCGAGTTAAGCAGT
CAATTCCTCTACCGAGGCCACCACACAGACTGGGAGAATATGTTCCGCAAAGTGGACGAGGAAGAGATGGAGCTC
TGCCCCCGTAGCCCGATGGAGGTTGCGATCTTGAACTCGAAGTCCTGGTTCCAGCCCCTGGATCGGTCGCTCGAC
CTGGAAAACCAGACTTTGGTCTTCGTACTTCGTTCGACCTACCAATACGCCAGCAAGGACACCTTCAAGACCGTT
ACTACTGTTGGTGAAGTTCGCGTGAATTCATCGCTCCCAGGTGGTTCGCGGCCGATTGCGACCGTAGACTATCAC
GCAGTCACCTGCCGAGGTAGCCCTGTCATGGATTACCTCAAGCGTCATGGTAGTCCAGTGCAGAAGCGCGCTATG
TTTGATCAGCCTAGTCCCTTGACTAACGATGGCGAATCTTTGATTCTCACTATGCCACACTCTAACGAGGCTTAT
GCTCACGTCTCCTGGGACTTCAATCCCATCCATGTGTCCGCGTCGCTGTCGCGATATGCAGATCTACCAGGTCTG
ATCACGCACAGCATGTACACCTCGGCACGGGTACGTGGACTTGTCGAACACTACACCTGTGCCTCAACCATCGGC
GCCTTCCGTAGCTTCCACTGCTCATTCACGAGTATGGTGCTACCGGGAGATAAGATTGAAGTCGTCTTCCAGCAC
ATCGGCATGTTGGCGGGACGCAAGATCGTCTCAGTGGAGGCAAAGCACGTCGGGCGCGGCGAGACCGTTCTGCGT
GGAGAAGCTGAGATCGAACCTGAGGAGACGGCATTCCTTTTCACTGGTCAGGGTAGTCAACAAAAGGGCATGGGT
ATGCAGCTCTATACCCAAAGCAAAGCGGCACAGCAGGTCTGGGATTATGCTGATGCCTACTTCTCCGATAACTAT
GGCTTCCGCATTACCGACATCGTGCGGAATGATCCCAAGGAGTTGACCGTCTACTTCGGAGGGCCTCAAGGCCGA
CACATCCGTGACCAATATCGTAGTATGACGCGAGAGTCCATTGGGCCCCTTTCGCGCCGAAACTCGCGCCAATGG
TCATAA
Gene >Pro_DTO377G3_2|g4366.t1
ATGTTGATCTCGACCGAATTGCCGGGGCCGTCGGCTGTCTTGTCGGCTTCGACTTCCTCGAACTGGTCAACGCCT
GATGAACTATCCACCTCGTCGTCGCCCAGCAACATTTGGGGCAGCCAAATCCTCACCATCACAGATGGCCGTTTC
ACACATACCCTCTCCATTTCTACTGCCTCATTCCCCGCTGCGCTTCAGCTGCGCGATGACTTTCTCCATGATCTT
CAAACCGCTGGTGGGGCCGAGCCGATATCCTCTCTGGTGGAGCTTTGAGCCCGCTTTATTGGTTTTACCGTGCGT
CGTTTAGAGCAATCTCCTCATGGATTGGCTGACGATCTCCGACATCTTTTGACCATCGCCCTCGATACCTTCGAT
CGTGATATTCTACTGCAGCGCGAGATCCATGGTGTAGTCTATGCCTTGGACATCTCCGCAGACGCCGAGTCGGCC
ATTTTAGCTGCTTACGTACGTGCGCGCCATGTTCTGCGCAAAGTCAGTCGACCAGCGGCACCTTCTGCGCTCCTG
GCTGCCGCGCAGCAACGCAAAGCACGACTATATGCTGTGTTCGGCGGGCAGGGCAATGATGAAGATTACTTTGAA
GAGCTGCGGATGCTCTGGCAGACCTATCGCCCGCTGGTGGAAGACCTCATTCCGTCAGTCTCGAGTATGCTGCAG
CGCGAGACCCGTGAGGAGAGCATTAGTCGATTCTATCACAACGGCATGGACATAGTCACCTGGCTCGAGAACCCG
GATCGTACGCCACCATCTGACTACCTAATCGGTGCGTCTATCAGTATGCCGCTCATCGGTTTGTTGCAGCTGGCC
TGGTATCGAGTCGTCGGACGCATAGTGGGTACCACACCTGCCCAGCTTCAGACCGCGCTTGCTGGAGCCACGGGA
CATTCTCAAGGCATCATCCCAGCCACTGTGATTGTAGTGGCACAATCATGGACGCAATTCGACGCGCTCGCGCTC
GATGCGCTTCGGTTGCTGCTCGCCATCGGAACTGCCAGCCAGGACCAATTTGCCGTGGGCCAGCTGCCGCCGGCT
GTTGTCGCAGACGCCGAAGCCAACGGCGAGGGCTTTCCAGGACCCATGCTGAGTGTGGCAGACTGTCCAATCTCC
CAGCTCCGCACCTATGTAGCTTCCGTCAATGGGTATTTGCCCGTTGATGCCCGCATTGAGATAGCTCTAATCAAC
GGGCCTACCAATGCCGTTTTGGCTGGACCGCCACTGTCACTTCATGGGTTTAATGTTTGGCTACGACAGGTGAAA
GCTCCGGCAAAGGGCTTGCAACATCGGATTCCTTTCAGCCAGCGAAAGCCTGAGATCCATACCAGATTCCTTCCA
ATAACCACGGCCTTCCACAGCAGCTATCTAACAGATGTCGCTCCGGGCGTGCTGGAGCGTGTCGCGGATTTCACC
ATAACCGGTGACCAACTCCGAATCCCTGTCTTTTGCACCCACACAGGGACAGATCTACGCAAGTGTGGAGCCGTC
AACTTGATTCCCAAGCTCATTGCGATGATAACGACCCAGCAAGTCGTCTGGCCACGGGCCGTGCATTTTCCCGGA
TCCACGCATATTCTTGCTTTTGGGCCTGATGGTGCATCTGGCATTGGAACTCTCACTAATCGACTCAAGGAGGGT
ACTGGCGTCCGTACTATCCTGGCCACGGGCATCTCCAGCTCCCGCACCGAGCTGGGAGATCGCAGTGAGTTCTTT
AACTGGAATCCTGCGCCCAAGGGTCTCGTCTACGGACCTATATGGCGGAATCGCTACCGACCGCAGTTGGTACAG
ATTGCCGGCGGCGGCGTGCTTGTCGATACTAAGCTCAGTCGCCTCTTGGGCTTGCCACCAGTCATGGTGGCCGGA
ATGACGCCCACAACTGCAGCCTGGGATTTCTGTGCGGCAGTTATGCGCGCCGGCTATCATGTCGAATTGGCACTG
GGCGGATTCCATCAAGCCGCCCAGTTGGAGACAGACGTTTACAAGCTGCTGGACGCGGTACCTGCTGGCCGGGGC
ATCACCTGCAACATGATCTACGCCGCTCCTCACGCGGTGAAGTGGCAGATTCCGCTGCTGGCCAAATTACGCGCG
GCCGGCGTTCCCCTGGAGGGACTCACTATCGGCGCAGGCGTGCCTTCACTCGAGGTGGCCACTCGGTACATCAAC
GAGCTCGGTCTACGCCACATGGGCTTCAAGCCTGGCACTTTACCCGCGATATACCAAGTCCTCGACATCGCATCG
GCTCATCCCACCTTCCCTATTCTACTCCAATGGACAGGTGGGCGAGGTGGTGGCCACCACTCATTCGAGGACTTC
CACCAACCGATCTTGCAAGCCTACGACTCCATCCGCCGCTGCGAGAACGTTATTCTTGTAGCGGGCAGTGGCTTT
GGCGGTGCACAGGACACATTCCCCTACCTAACAGGTGATTGGGCCTGTCGGTATAACCGCCCGCCCATGCCCTTC
GATGGTATCCTTCTCGGCAGTCGTTTGATGACCGCCAAAGAAGCGCATACCAGCCCAGCTGTGAAACAGGCAATT
GTGAATGCGCCAGGAGTCGAGGATGAAGGTGATTGGGAGCAGACATACACACAACCAGCTGGCGGCATTATGACT
GTAACCTCAGAGATGGGGGAACCTATTCATAAGCTGGCTACGCGGGGTGTGCAACTATGGGCTGAGTTAGATCGC
AATGTCTTCAGCCTTGATCGTAGTAAGCGCGTCGCGTATCTGCAGAAACACCGTGACTACCTGATTCAGCGACTG
AATACCGATTCGGTGAAGGTCTGGTTTGGGTGCGATGTCCAGGGATCTGTTATCGACTTGGAGGAGATGACTTAC
GCCGAGGTTCTGCGCCGTTTTATTGCGCTTACCTATGTGTCGGCTGAGGGCCGCTGGATCGATGATTCCTACCGC
TTGTTCCTGCAAGATTTCCTAAAGCGCGTGGATGCCCGCATTGGCGACGTAGCCCCCGGCCCCGGACTCAGCGAA
GTCAACGGCGACGAGGCTCTTGCTGATCCGACAACAGCGCTGAACGCCATCTTGAAGCGGTTGCCGACCGCTGAG
GCCCAGCTTATTGGCACGCAAGATGCGGAATACTTTTTGCTTCTATGCCAGAGACGCGGCACAAAGCCAGTACCG
TTTGTCCCTGTCCTCGACGAAAACTTCGAGACTTACTTCAAAAAAGACTCGCTGTGGCAGTCAGAGGATCTTGCA
GCTGTTGCTGACGCTGATGTCGGCCGGGTACGGCCCAGTGGCGGCGCGATATTCAACTAAGGTGGACGAGCCGGC
AGGCGACATTTTAGGCAACATCTACCATGGACACATTGAGTGCCTGCAGCAGCAAGATCCCGAATACCAGCAGGA
TGGTATCCCTATTGTCGACTGCTTCAGCCCATACTCTGTCCCACAGGACTGGCGACTTGCGGAGCTGGGCATTCA
TTGCTCGCCCGTCGGAAACACAGGCGCGATGTTATATGAAGTGAAACCACTGGACGGTGCGCCCGGTGCGCCACC
AACACCCTCGTTAGCAGAATGGCTTGTGGCCTTGGGCGGTTCCAATGGAGGCTGGCGCCAAGCATTCTTCCACGC
AGCGACGATCGTGCAGGGCCGAGCCATCTGCGAGAATCCGCTGCGGCGGCTTTTCCAGCCCACGCGTGAATCATA
CGTGATGGTGCAGCAGGGCCACGGAGGCCTTTCGGCAGATCCGATAATCACGCTGTTCGAACATCGGCCACACTC
TGAGCCGGTCAAGGTCGTGGAGGTGCGAGTGGATGAGCCTAGCGTTATCACGCTTGAGATCATCAACTACCGTAA
TGCTGGAGGTGCCGCTATTGGGCTGCAGTTGAAGTTCCAGTTCAGGCGTGAGGCTGTTTACGCTCCCATCCATGA
AATTATGGAAGGCCGCAACCAGCGTGTCAAAGACTTCTACTATAGAGTCTGGTTCGCGGGTGAACCACCAGAGAC
ATGGCCCTCGGTCCACGACACCTTCCGCGAATCGCAGTTTGAGGTGACGGCCGACTCAATCGCCGAGTTCGCCCA
TTGTGTACAGAATGCCAGCGATGCCGCTAGCAAGCGGCGTGGCAAACGGATGGCGGCACCGTTGGACTTTGGTGT
CGTCATTGGCTGGGAAGCTTTGATGAAGCCGCTTTTCTCGCGGGAGCTTGACGTCGATCTGTTGACGCTGGTGCA
TCTCACCAATGGCTTCCGCATTCCCGCAGATGCGGACCCCATTCAGGCAGGTTATGCACTTGAGACCAAGTCTCG
TATACAAGCCATTACGATCGAGGAGACAGGTAAATTGGTCGAGGTACGTGCGGATGTGTACCATGAGAATAAGGT
CGTGCTCGAGTTAAGCAGTCAATTCCTCTACCGAGGCCACCACACAGACTGGGAGAATATGTTCCGCAAAGTGGA
CGAGGAAGAGATGGAGCTCTGCCCCCGTAGCCCGATGGAGGTTGCGATCTTGAACTCGAAGTCCTGGTTCCAGCC
CCTGGATCGGTCGCTCGACCTGGAAAACCAGACTTTGGTCTTCGTACTTCGTTCGACCTACCAATACGCCAGCAA
GGACACCTTCAAGACCGTTACTACTGTTGGTGAAGTTCGCGTGAATTCATCGCTCCCAGGTGGTTCGCGGCCGAT
TGCGACCGTAGACTATCACGCAGTCACCTGCCGAGGTAGCCCTGTCATGGATTACCTCAAGCGTCATGGTAGTCC
AGTGCAGAAGCGCGCTATGTTTGATCAGCCTAGTCCCTTGACTAACGATGGCGAATCTTTGATTCTCACTATGCC
ACACTCTAACGAGGCTTATGCTCACGTCTCCTGGGACTTCAATCCCATCCATGTGTCCGCGTCGCTGTCGCGATA
TGCAGATCTACCAGGTCTGATCACGCACAGCATGTACACCTCGGCACGGGTACGTGGACTTGTCGAACACTACAC
CTGTGCCTCAACCATCGGCGCCTTCCGTAGCTTCCACTGCTCATTCACGAGTATGGTGCTACCGGGAGATAAGAT
TGAAGTCGTCTTCCAGCACATCGGCATGTTGGCGGGACGCAAGATCGTCTCAGTGGAGGCAAAGCACGTCGGGCG
CGGCGAGACCGTTCTGCGTGGAGAAGCTGAGATCGAACCTGAGGAGACGGCATTCCTTTTCACTGGTCAGGGTAG
TCAACAAAAGGGCATGGGTATGCAGCTCTATACCCAAAGCAAAGCGGCACAGCAGGTCTGGGATTATGCTGATGC
CTACTTCTCCGATAACTATGGCTTCCGCATTACCGACATCGTGCGGAATGATCCCAAGGAGTTGACCGTCTACTT
CGGAGGGCCTCAAGGCCGACACATCCGTGACCAATATCGTAGTATGACGCGAGAGTCCATTGGGCCCCTTTCGCG
CCGAAACTCGCGCCAATGGTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail