Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4352.t1
Gene name
Locationscaffold_09:32513..34113
Strand-
Gene length (bp)1600
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-33 42 409

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 33 50 17
2 104 121 17
3 131 153 22
4 165 187 22
5 197 219 22
6 267 288 21
7 303 325 22
8 332 351 19
9 356 378 22
10 391 413 22
11 423 445 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 20.44 10.34 30.54
5d_25C Five days - 25 degrees Celsius 11.24 4.84 17.65
7d_25C Seven days - 25 degrees Celsius 11.51 4.92 18.11
10d_25C Ten days - 25 degrees Celsius 5.93 2.00 9.87
7d_15C Seven days - 15 degrees Celsius 10.97 4.38 17.56
7d_30C Seven days - 30 degrees Celsius 12.95 5.50 20.40

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.040199 yes
3d_25C 7d_25C 0.049197 yes
3d_25C 7d_15C 0.036724 yes
3d_25C 7d_30C 0.115777 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.964034 no
5d_25C 7d_15C 0.963414 no
5d_25C 7d_30C 0.740158 no
5d_25C 10d_25C 0.064808 no
7d_25C 7d_15C 0.923881 no
7d_25C 7d_30C 0.792977 no
7d_25C 10d_25C 0.052372 no
7d_15C 7d_30C 0.692477 no
7d_15C 10d_25C 0.079264 no
7d_30C 10d_25C 0.022681 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4352.t1
MGHAEPDLGPADEISLGPTLDEEQIEKTLIRKIDLHILPIVVLLYLFSFLDRVNIGNARLYGLEEDLGLVGNQYQ
VSVSILFVTYCFFEVPSNLVLKKLRPSRYIATISILWGIIATLTGITRDYGDLVACRILLGVVEAGLFPGFITYL
TLFYSKREIALRTSYLFSSAAIAGAFGGLLAYGIGFMDGICGLRGWRWIMIIEGIPTVLLGVVTWFALADDPDTA
YYLNKEERALVTLRRSRYIGQTESAQKFHWADVKEGVLDWKIWAFSIGQFGIDTMLYGYSTFLPTIIKGMGNWTT
AEVQALTIPCYALGAFAYLCVAWLSDRTQHRAFFICLFCAISVVGYGILISDSSSGVHYFGALMVALGLYVAVGL
PLAWLPTNLPRYAKRTYATGLQLTFGNISGVMSPFLYPNSEGPRFVRGNAVTLAMVGFAGVVYGVMWVSYRVINK
RRAQGLEDDKISSLSEQAIQEMGDRNPRFLYSI*
Coding >Pro_DTO377G3_2|g4352.t1
ATGGGCCATGCTGAGCCTGACCTCGGCCCAGCCGATGAAATCAGCTTAGGGCCAACTCTTGATGAAGAACAGATC
GAGAAAACTCTGATCAGGAAGATTGACCTGCATATCCTTCCTATCGTGGTGTTGTTGTATCTCTTCAGTTTCCTA
GACCGAGTCAACATTGGAAATGCACGATTGTACGGCCTGGAAGAGGACTTGGGGCTTGTTGGCAACCAGTACCAA
GTCTCGGTGTCTATCCTTTTTGTGACCTACTGTTTCTTTGAGGTCCCTTCGAATCTCGTACTCAAGAAACTACGG
CCGTCTCGGTATATTGCCACGATCTCAATTTTGTGGGGTATCATTGCAACCCTCACAGGAATCACTCGGGATTAT
GGTGACTTGGTTGCCTGTCGGATCCTACTCGGAGTCGTAGAAGCAGGTCTTTTCCCGGGCTTTATCACCTACCTC
ACTCTCTTCTATAGCAAACGTGAGATTGCCTTGCGAACAAGCTACCTCTTTAGCAGTGCAGCTATTGCGGGAGCC
TTTGGCGGGTTACTGGCTTATGGTATTGGGTTTATGGACGGCATCTGTGGACTTCGCGGCTGGCGTTGGATCATG
ATCATCGAGGGGATTCCGACAGTTTTACTTGGTGTGGTGACTTGGTTCGCCTTGGCAGATGACCCGGACACAGCT
TATTATCTAAACAAAGAGGAGCGAGCGCTTGTTACCCTTCGCCGGAGTCGTTATATCGGCCAAACAGAGTCTGCA
CAGAAGTTTCACTGGGCGGATGTAAAAGAGGGTGTCTTAGACTGGAAGATCTGGGCGTTCTCCATTGGCCAGTTT
GGTATTGATACCATGCTCTATGGATATAGTACCTTCCTTCCTACTATTATCAAAGGCATGGGAAATTGGACCACC
GCCGAGGTCCAGGCATTGACAATCCCTTGCTATGCACTGGGTGCCTTTGCCTATCTGTGCGTTGCCTGGTTGAGC
GATCGCACCCAACACCGTGCATTTTTCATATGTCTCTTCTGCGCTATCTCAGTCGTTGGCTATGGAATCTTGATT
TCGGACTCGTCCTCGGGTGTTCATTACTTTGGTGCCTTGATGGTCGCCCTGGGACTTTACGTTGCTGTCGGCTTA
CCTCTCGCCTGGTTGCCTACCAATCTGCCCCGATACGCAAAACGCACCTACGCAACTGGCTTGCAGCTTACCTTT
GGCAACATCAGCGGAGTTATGTCCCCTTTCTTGTATCCTAATTCGGAAGGCCCGCGCTTCGTCCGTGGGAACGCT
GTCACTCTGGCAATGGTGGGATTTGCGGGGGTTGTATATGGTGTCATGTGGGTTTCCTACCGGGTTATCAACAAA
CGCAGGGCCCAGGGATTGGAGGACGACAAAATATCATCGCTCTCAGAGCAGGCTATCCAAGAAATGGGCGATCGA
AACCCCAGGTTCTTGTACAGCATTTAA
Transcript >Pro_DTO377G3_2|g4352.t1
ATGGGCCATGCTGAGCCTGACCTCGGCCCAGCCGATGAAATCAGCTTAGGGCCAACTCTTGATGAAGAACAGATC
GAGAAAACTCTGATCAGGAAGATTGACCTGCATATCCTTCCTATCGTGGTGTTGTTGTATCTCTTCAGTTTCCTA
GACCGAGTCAACATTGGAAATGCACGATTGTACGGCCTGGAAGAGGACTTGGGGCTTGTTGGCAACCAGTACCAA
GTCTCGGTGTCTATCCTTTTTGTGACCTACTGTTTCTTTGAGGTCCCTTCGAATCTCGTACTCAAGAAACTACGG
CCGTCTCGGTATATTGCCACGATCTCAATTTTGTGGGGTATCATTGCAACCCTCACAGGAATCACTCGGGATTAT
GGTGACTTGGTTGCCTGTCGGATCCTACTCGGAGTCGTAGAAGCAGGTCTTTTCCCGGGCTTTATCACCTACCTC
ACTCTCTTCTATAGCAAACGTGAGATTGCCTTGCGAACAAGCTACCTCTTTAGCAGTGCAGCTATTGCGGGAGCC
TTTGGCGGGTTACTGGCTTATGGTATTGGGTTTATGGACGGCATCTGTGGACTTCGCGGCTGGCGTTGGATCATG
ATCATCGAGGGGATTCCGACAGTTTTACTTGGTGTGGTGACTTGGTTCGCCTTGGCAGATGACCCGGACACAGCT
TATTATCTAAACAAAGAGGAGCGAGCGCTTGTTACCCTTCGCCGGAGTCGTTATATCGGCCAAACAGAGTCTGCA
CAGAAGTTTCACTGGGCGGATGTAAAAGAGGGTGTCTTAGACTGGAAGATCTGGGCGTTCTCCATTGGCCAGTTT
GGTATTGATACCATGCTCTATGGATATAGTACCTTCCTTCCTACTATTATCAAAGGCATGGGAAATTGGACCACC
GCCGAGGTCCAGGCATTGACAATCCCTTGCTATGCACTGGGTGCCTTTGCCTATCTGTGCGTTGCCTGGTTGAGC
GATCGCACCCAACACCGTGCATTTTTCATATGTCTCTTCTGCGCTATCTCAGTCGTTGGCTATGGAATCTTGATT
TCGGACTCGTCCTCGGGTGTTCATTACTTTGGTGCCTTGATGGTCGCCCTGGGACTTTACGTTGCTGTCGGCTTA
CCTCTCGCCTGGTTGCCTACCAATCTGCCCCGATACGCAAAACGCACCTACGCAACTGGCTTGCAGCTTACCTTT
GGCAACATCAGCGGAGTTATGTCCCCTTTCTTGTATCCTAATTCGGAAGGCCCGCGCTTCGTCCGTGGGAACGCT
GTCACTCTGGCAATGGTGGGATTTGCGGGGGTTGTATATGGTGTCATGTGGGTTTCCTACCGGGTTATCAACAAA
CGCAGGGCCCAGGGATTGGAGGACGACAAAATATCATCGCTCTCAGAGCAGGCTATCCAAGAAATGGGCGATCGA
AACCCCAGGTTCTTGTACAGCATTTAA
Gene >Pro_DTO377G3_2|g4352.t1
ATGGGCCATGCTGAGCCTGACCTCGGCCCAGCCGATGAAATCAGCTTAGGGCCAACTCTTGATGAAGAACAGATC
GAGAAAACTCTGATCAGGAAGATTGACCTGCATATCCTTCCTATCGTGGTGTTGTTGTATCTCTTCAGTTTCCTA
GACCGAGGTACGTGGGGGTGGGATGCCTGACTCATCCCTTTGTGATTGCAACTGGCTTGTGCCAACTCGGAATCA
AGAACATTGGCTGACTTGAATATGCAGTCAACATTGGAAATGCACGATTGTACGGCCTGGAAGAGGACTTGGGGC
TTGTTGGCAACCAGTACCAAGTCTCGGTGTCTATCCTTTTTGTGACCTACTGTGTATGTATATCACGCAATTCAG
TCACCGCACGGACGCTAATCCTCACGTTCAGTTCTTTGAGGTCCCTTCGAATCTCGTACTCAAGAAACTACGGCC
GTCTCGGTATATTGCCACGATCTCAATTTTGTGGGGTATCATTGCAACCCTCACAGGAATCACTCGGGATTATGG
TGACTTGGTTGCCTGTCGGATCCTACTCGGAGTCGTAGAAGCAGGTCTTTTCCCGGGCTTTATCACCTACCTCAC
TCTCTTCTATAGCAAACGTGAGATTGCCTTGCGAACAAGCTACCTCTTTAGCAGTGCAGCTATTGCGGGAGCCTT
TGGCGGGTTACTGGCTTATGGTATTGGGTTTATGGACGGCATCTGTGGACTTCGCGGCTGGCGTTGGATCATGAT
CATCGAGGGGATTCCGACAGTTTTACTTGGTGTGGTGACTTGGTTCGCCTTGGCAGATGACCCGGACACAGCTTA
TTATCTAAACAAAGAGGAGCGAGCGCTTGTTACCCTTCGCCGGAGTCGTTATATCGGCCAAACAGAGTCTGCACA
GAAGTTTCACTGGGCGGATGTAAAAGAGGGTGTCTTAGACTGGAAGATCTGGGCGTTCTCCATTGGCCAGTTTGG
TATTGATACCATGCTCTATGGATATAGTACCTTCCTTCCTACTATTATCAAAGGCATGGGAAATTGGACCACCGC
CGAGGTCCAGGCATTGACAATCCCTTGCTATGCACTGGGTGCCTTTGCCTATCTGTGCGTTGCCTGGTTGAGCGA
TCGCACCCAACACCGTGCATTTTTCATATGTCTCTTCTGCGCTATCTCAGTCGTTGGCTATGGAATCTTGATTTC
GGACTCGTCCTCGGGTGTTCATTACTTTGGTGCCTTGATGGTCGCCCTGGGACTTTACGTTGCTGTCGGCTTACC
TCTCGCCTGGTTGCCTACCAATCTGCCCCGATACGCAAAACGCACCTACGCAACTGGCTTGCAGCTTACCTTTGG
CAACATCAGCGGAGTTATGTCCCCTTTCTTGTATCCTAATTCGGAAGGCCCGCGCTTCGTCCGTGGGAACGCTGT
CACTCTGGCAATGGTGGGATTTGCGGGGGTTGTATATGGTGTCATGTGGGTTTCCTACCGGGTTATCAACAAACG
CAGGGCCCAGGGATTGGAGGACGACAAAATATCATCGCTCTCAGAGCAGGCTATCCAAGAAATGGGCGATCGAAA
CCCCAGGTTCTTGTACAGCATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail