Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4349.t1
Gene name
Locationscaffold_09:19097..21088
Strand+
Gene length (bp)1991
Transcript length (bp)1872
Coding sequence length (bp)1872
Protein length (aa) 624

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05653 Mg_trans_NIPA Magnesium transporter NIPA 2.7E-10 214 325

GO

GO Term Description Terminal node
GO:0015095 magnesium ion transmembrane transporter activity Yes
GO:0015693 magnesium ion transport Yes
GO:0016021 integral component of membrane Yes
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0008324 cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0030001 metal ion transport No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0046873 metal ion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 11 33 22
2 59 81 22
3 86 105 19
4 112 134 22
5 154 176 22
6 210 232 22
7 247 269 22
8 276 295 19
9 305 327 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 31.83 18.64 45.01
5d_25C Five days - 25 degrees Celsius 25.71 14.60 36.82
7d_25C Seven days - 25 degrees Celsius 27.82 15.91 39.74
10d_25C Ten days - 25 degrees Celsius 27.26 15.56 38.95
7d_15C Seven days - 15 degrees Celsius 32.35 18.98 45.73
7d_30C Seven days - 30 degrees Celsius 23.04 12.82 33.26

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.412490 no
3d_25C 7d_25C 0.648227 no
3d_25C 7d_15C 0.966089 no
3d_25C 7d_30C 0.186190 no
3d_25C 10d_25C 0.587906 no
5d_25C 7d_25C 0.814885 no
5d_25C 7d_15C 0.371203 no
5d_25C 7d_30C 0.732994 no
5d_25C 10d_25C 0.869540 no
7d_25C 7d_15C 0.601457 no
7d_25C 7d_30C 0.513425 no
7d_25C 10d_25C 0.958413 no
7d_15C 7d_30C 0.156474 no
7d_15C 10d_25C 0.540350 no
7d_30C 10d_25C 0.569382 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4349.t1
MGNLGDLSPEGSVAVGVIVGLISTSLQAIGLTLQRKSHLLEDEKHPYDVRRPPYKRRRWQIGMGMFVISNIVGST
IQITTLPLPVLSTLQASGLVFNTIFATLILSEPFTRYSLAGTVLVCAGALLIATFGAIGEPAHTLDQLLDLLQRR
SFLLWMGATTLLVVLVLVGTKMLKLFLPSSRAKPSASGHFSPHLLRLQSRMRLIRGMSYGFVSGILSAHSLLLAK
SAVELLVRTMVDGVNQFNRWQSWVILLGMIFLALTQLFYLHRGLKLCSTSVLYPFVFCIYNIIAILDGLIYFRQM
SQLTGFHAGLIALGTMILLGGVLCLSWRLEDIDTHTAVTTLGSTQTGLGPGMGIVEEHSPASPGLLDGQDEESQI
RECEPLLNPKTHTRHLSYQRGRAPSLPLNLHFDRDSADINPASIWAELDDSDYESTDGHRQSSIDRLRSVSGSAT
LNGSLRGLTRQSTAGAITHDRERGSRRIQETSREDPWLRTSGPQSGLSAVHRKRRRGGDPFTSSSNQDIGGYGTI
QGDGDDTHWRGDSPIIRSSARSGLLNGSKRALAGAWRFGRQYLPRWSSPPAGIDPEDGSSSSLLPHSGVPLPRTH
YPQGIPVPESDTFRPSSSPTTSI*
Coding >Pro_DTO377G3_2|g4349.t1
ATGGGCAATCTAGGTGACTTGTCACCGGAGGGAAGTGTTGCGGTTGGTGTAATCGTTGGACTGATATCAACCAGC
CTCCAAGCTATCGGGCTCACGCTCCAGCGCAAGTCGCATTTGCTCGAGGATGAGAAGCACCCCTACGATGTGCGC
AGACCCCCCTACAAGCGCCGACGATGGCAAATAGGAATGGGGATGTTTGTCATTTCCAATATTGTTGGAAGTACC
ATACAAATCACTACACTTCCGTTACCAGTCCTCTCGACGCTCCAAGCGTCCGGACTAGTGTTCAATACTATATTT
GCGACCCTCATCCTCAGTGAACCCTTTACCCGATATTCTCTCGCAGGCACCGTTCTCGTCTGCGCCGGCGCGTTG
TTAATTGCGACCTTCGGGGCCATCGGGGAACCCGCACATACCTTGGATCAGCTCCTGGACCTTCTTCAGCGACGG
TCGTTTCTTCTGTGGATGGGTGCCACTACACTCCTGGTTGTCCTGGTACTTGTTGGTACCAAAATGCTGAAACTC
TTCCTACCGTCCTCACGCGCGAAACCCTCGGCCTCTGGTCATTTTTCACCACATCTACTGCGATTGCAAAGCCGA
ATGAGATTGATCCGCGGCATGAGCTATGGATTTGTCAGTGGTATACTGTCGGCTCACTCCCTTTTGCTAGCAAAG
TCGGCCGTGGAGCTTCTCGTGCGCACAATGGTAGACGGTGTGAACCAGTTCAATCGTTGGCAATCATGGGTTATC
CTGCTAGGAATGATCTTCCTAGCACTCACACAGCTATTCTATCTCCATAGGGGCCTGAAGCTGTGTAGTACTAGT
GTACTATATCCTTTTGTGTTCTGCATCTATAACATCATTGCTATCTTGGATGGCCTGATCTACTTCCGGCAAATG
TCCCAGCTGACGGGCTTCCACGCCGGTCTCATCGCTTTGGGAACAATGATTCTCCTAGGTGGTGTTTTGTGCCTG
TCATGGCGACTTGAGGATATCGACACTCATACCGCTGTCACCACTTTGGGTTCCACGCAAACCGGACTTGGGCCG
GGTATGGGAATCGTGGAAGAGCACTCTCCGGCATCACCTGGTTTGCTGGACGGTCAGGATGAGGAATCACAGATT
AGAGAATGCGAGCCACTTCTCAACCCGAAAACCCATACTCGCCATCTTTCATATCAGCGGGGAAGAGCTCCGAGC
CTGCCACTCAACTTGCATTTTGATCGCGACTCAGCTGATATAAACCCCGCATCTATTTGGGCTGAACTCGACGAT
TCGGACTATGAATCTACCGATGGACACAGGCAGTCCTCCATAGATCGCCTGCGTAGCGTCAGTGGTAGTGCAACC
CTCAACGGCTCATTGCGGGGTCTGACACGGCAATCGACGGCCGGCGCTATTACACACGATCGCGAAAGAGGATCT
CGCCGAATCCAAGAAACATCACGTGAGGACCCATGGCTTCGCACCTCAGGACCTCAGAGTGGGTTATCGGCCGTC
CATCGTAAACGTCGGAGGGGCGGGGATCCGTTCACCTCATCGTCTAACCAAGACATCGGTGGGTACGGAACCATC
CAAGGGGATGGCGATGATACTCACTGGCGCGGCGACTCCCCTATCATTCGTTCGTCTGCCAGGTCTGGTCTTCTT
AATGGCTCAAAAAGGGCTCTGGCAGGTGCCTGGAGGTTTGGGAGACAATATCTGCCTCGATGGAGTAGCCCGCCG
GCTGGGATTGACCCAGAAGATGGCTCTTCCTCATCCCTACTCCCCCACTCTGGCGTCCCTCTTCCACGAACACAC
TATCCACAGGGAATCCCGGTTCCTGAATCTGACACCTTTCGGCCATCGTCATCCCCAACCACCTCTATATAA
Transcript >Pro_DTO377G3_2|g4349.t1
ATGGGCAATCTAGGTGACTTGTCACCGGAGGGAAGTGTTGCGGTTGGTGTAATCGTTGGACTGATATCAACCAGC
CTCCAAGCTATCGGGCTCACGCTCCAGCGCAAGTCGCATTTGCTCGAGGATGAGAAGCACCCCTACGATGTGCGC
AGACCCCCCTACAAGCGCCGACGATGGCAAATAGGAATGGGGATGTTTGTCATTTCCAATATTGTTGGAAGTACC
ATACAAATCACTACACTTCCGTTACCAGTCCTCTCGACGCTCCAAGCGTCCGGACTAGTGTTCAATACTATATTT
GCGACCCTCATCCTCAGTGAACCCTTTACCCGATATTCTCTCGCAGGCACCGTTCTCGTCTGCGCCGGCGCGTTG
TTAATTGCGACCTTCGGGGCCATCGGGGAACCCGCACATACCTTGGATCAGCTCCTGGACCTTCTTCAGCGACGG
TCGTTTCTTCTGTGGATGGGTGCCACTACACTCCTGGTTGTCCTGGTACTTGTTGGTACCAAAATGCTGAAACTC
TTCCTACCGTCCTCACGCGCGAAACCCTCGGCCTCTGGTCATTTTTCACCACATCTACTGCGATTGCAAAGCCGA
ATGAGATTGATCCGCGGCATGAGCTATGGATTTGTCAGTGGTATACTGTCGGCTCACTCCCTTTTGCTAGCAAAG
TCGGCCGTGGAGCTTCTCGTGCGCACAATGGTAGACGGTGTGAACCAGTTCAATCGTTGGCAATCATGGGTTATC
CTGCTAGGAATGATCTTCCTAGCACTCACACAGCTATTCTATCTCCATAGGGGCCTGAAGCTGTGTAGTACTAGT
GTACTATATCCTTTTGTGTTCTGCATCTATAACATCATTGCTATCTTGGATGGCCTGATCTACTTCCGGCAAATG
TCCCAGCTGACGGGCTTCCACGCCGGTCTCATCGCTTTGGGAACAATGATTCTCCTAGGTGGTGTTTTGTGCCTG
TCATGGCGACTTGAGGATATCGACACTCATACCGCTGTCACCACTTTGGGTTCCACGCAAACCGGACTTGGGCCG
GGTATGGGAATCGTGGAAGAGCACTCTCCGGCATCACCTGGTTTGCTGGACGGTCAGGATGAGGAATCACAGATT
AGAGAATGCGAGCCACTTCTCAACCCGAAAACCCATACTCGCCATCTTTCATATCAGCGGGGAAGAGCTCCGAGC
CTGCCACTCAACTTGCATTTTGATCGCGACTCAGCTGATATAAACCCCGCATCTATTTGGGCTGAACTCGACGAT
TCGGACTATGAATCTACCGATGGACACAGGCAGTCCTCCATAGATCGCCTGCGTAGCGTCAGTGGTAGTGCAACC
CTCAACGGCTCATTGCGGGGTCTGACACGGCAATCGACGGCCGGCGCTATTACACACGATCGCGAAAGAGGATCT
CGCCGAATCCAAGAAACATCACGTGAGGACCCATGGCTTCGCACCTCAGGACCTCAGAGTGGGTTATCGGCCGTC
CATCGTAAACGTCGGAGGGGCGGGGATCCGTTCACCTCATCGTCTAACCAAGACATCGGTGGGTACGGAACCATC
CAAGGGGATGGCGATGATACTCACTGGCGCGGCGACTCCCCTATCATTCGTTCGTCTGCCAGGTCTGGTCTTCTT
AATGGCTCAAAAAGGGCTCTGGCAGGTGCCTGGAGGTTTGGGAGACAATATCTGCCTCGATGGAGTAGCCCGCCG
GCTGGGATTGACCCAGAAGATGGCTCTTCCTCATCCCTACTCCCCCACTCTGGCGTCCCTCTTCCACGAACACAC
TATCCACAGGGAATCCCGGTTCCTGAATCTGACACCTTTCGGCCATCGTCATCCCCAACCACCTCTATATAA
Gene >Pro_DTO377G3_2|g4349.t1
ATGGGCAATCTAGGTGACTTGTCACCGGAGGGAAGTGTTGCGGTAAGACTACGGAAATCAGGATATACAGCGAGA
TAAGATCCAAAGCTAATTATGTATCAGGTTGGTGTAATCGTTGGACTGATATCAACCAGCCTCCAAGCTATCGGG
CTCACGCTCCAGCGCAAGTCGCATTTGCTCGAGGATGAGAAGCACCCCTACGATGTGCGCAGACCCCCCTACAAG
CGCCGACGATGGCAAATAGGAATGGGGATGTTTGTCATTTCCAATATTGTTGGAAGTACCATACAAATCACTACA
CTTCCGTTACCAGTCCTCTCGACGCTCCAAGCGGTCAGTAGTTCCCCCTCCATGCATGCCGGAGATTGGTTGCTG
ATAGGAATGCCGAATAGTCCGGACTAGTGTTCAATACTATATTTGCGACCCTCATCCTCAGTGAACCCTTTACCC
GATATTCTCTCGCAGGCACCGTTCTCGTCTGCGCCGGCGCGTTGTTAATTGCGACCTTCGGGGCCATCGGGGAAC
CCGCACATACCTTGGATCAGCTCCTGGACCTTCTTCAGCGACGGTCGTTTCTTCTGTGGATGGGTGCCACTACAC
TCCTGGTTGTCCTGGTACTTGTTGGTACCAAAATGCTGAAACTCTTCCTACCGTCCTCACGCGCGAAACCCTCGG
CCTCTGGTCATTTTTCACCACATCTACTGCGATTGCAAAGCCGAATGAGATTGATCCGCGGCATGAGCTATGGAT
TTGTCAGTGGTATACTGTCGGCTCACTCCCTTTTGCTAGCAAAGTCGGCCGTGGAGCTTCTCGTGCGCACAATGG
TAGACGGTGTGAACCAGTTCAATCGTTGGCAATCATGGGTTATCCTGCTAGGAATGATCTTCCTAGCACTCACAC
AGCTATTCTATCTCCATAGGGGCCTGAAGCTGTGTAGTACTAGTGTACTATATCCTTTTGTGTTCTGCATCTATA
ACATCATTGCTATCTTGGATGGCCTGATCTACTTCCGGCAAATGTCCCAGCTGACGGGCTTCCACGCCGGTCTCA
TCGCTTTGGGAACAATGATTCTCCTAGGTGGTGTTTTGTGCCTGTCATGGCGACTTGAGGATATCGACACTCATA
CCGCTGTCACCACTTTGGGTTCCACGCAAACCGGACTTGGGCCGGGTATGGGAATCGTGGAAGAGCACTCTCCGG
CATCACCTGGTTTGCTGGACGGTCAGGATGAGGAATCACAGATTAGAGAATGCGAGCCACTTCTCAACCCGAAAA
CCCATACTCGCCATCTTTCATATCAGCGGGGAAGAGCTCCGAGCCTGCCACTCAACTTGCATTTTGATCGCGACT
CAGCTGATATAAACCCCGCATCTATTTGGGCTGAACTCGACGATTCGGACTATGAATCTACCGATGGACACAGGC
AGTCCTCCATAGATCGCCTGCGTAGCGTCAGTGGTAGTGCAACCCTCAACGGCTCATTGCGGGGTCTGACACGGC
AATCGACGGCCGGCGCTATTACACACGATCGCGAAAGAGGATCTCGCCGAATCCAAGAAACATCACGTGAGGACC
CATGGCTTCGCACCTCAGGACCTCAGAGTGGGTTATCGGCCGTCCATCGTAAACGTCGGAGGGGCGGGGATCCGT
TCACCTCATCGTCTAACCAAGACATCGGTGGGTACGGAACCATCCAAGGGGATGGCGATGATACTCACTGGCGCG
GCGACTCCCCTATCATTCGTTCGTCTGCCAGGTCTGGTCTTCTTAATGGCTCAAAAAGGGCTCTGGCAGGTGCCT
GGAGGTTTGGGAGACAATATCTGCCTCGATGGAGTAGCCCGCCGGCTGGGATTGACCCAGAAGATGGCTCTTCCT
CATCCCTACTCCCCCACTCTGGCGTCCCTCTTCCACGAACACACTATCCACAGGGAATCCCGGTTCCTGAATCTG
ACACCTTTCGGCCATCGTCATCCCCAACCACCTCTATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail