Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4346.t1
Gene name
Locationscaffold_09:8084..12802
Strand-
Gene length (bp)4718
Transcript length (bp)4542
Coding sequence length (bp)4542
Protein length (aa) 1514

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 4.9E-81 1098 1347
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 3.9E-19 114 164
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.6E-11 756 835

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 133 155 22
2 160 182 22
3 515 537 22
4 560 582 22
5 1133 1150 17
6 1160 1182 22
7 1213 1235 22
8 1250 1272 22
9 1279 1301 22
10 1311 1333 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4346.t1
MASARFPGDNGEDEGDNNEQGADIGEVNSHVSKPTKRQRWATTRAPGHGGVKKRVSIIDRFHKRSDLKDEKRKSN
NTSTSGNSESQIPQEGPNRRIYFSIPIPESERDEDGHLRITYPRNKIRTAKYTPLTFVPYNIWLQFHNIANIYFL
FVIILNCFPIFGANNPGLNAVPLIVIIVVTAIKDAIEDWGRTVSDNQVNNSPVYRLVEWNNVNSTEDNIDIWRRV
KKACTRGSIASYKWVVSQFKKKEKEGDDDEGQRRDSFLSTADRRSSIYTQRNSLAPEDIAIPMTDVPSPQPEARE
DWPIVSNPENKYLSPNSAARQSVVEPTPDKKHGTILDMSKQTPGKARFKREQWKSLQVGDFVRLYNEDPIPADVV
ILSTSDPDGACYVETKGLDGETNLKVRQALHCGHEVRHARDCEKAEFVIESEAPHANLYTYNGAIRWDQRDPRFP
EAPRKEMVEPISINNILLRGCNLKSTEWVLGVVLFTGGESKIMLNSGATPAKRPRMAKDLNWNVIYNFFILFLMC
IVAGIVNGIAWARPDKSLDYFDLESYGGTPPVTGIVTFWTALILFQNLVPISLYISLEIVRTIQALFINNDLFMY
YERLGIYCVPKSWNISDDVGQVEYIFSDKTGTLTQNLMEFKKCTVNGLAYGEAYTEAQVGMRRREGADADAEAAV
ARQQIAADAQKMLGLLRGIHDNPYLHDDQLTFVAPNFVADLTGQSGERQKHCTEDFMLALALCHTVITEHTPGDP
PQIEFKAQSPDEAALVSTARDCGFTVLGRAGDDLLLNVMGEERTYTVLNTLEFNSSRKRMSAIIRMPDGTIRLFC
KGADSIIYSRLARGKQQELRRQTAEHLEEFAREGLRTLCVADRLLSEDEYYTWAKEHDIAAAAITDREEKLEMVS
SQIEQELMLIGGTAIEDRLQDGVPDTIQLLADAGIKLWVLTGDKVETAINIGFSCNLLNNNMELIVLNIPETEHQ
QASDELDKNLQTFGLTGSDEELIAARADHTPPEATHAVVVDGETLKLMLSDDLKQKFLLLCKQCKAVLCCRVSPA
QKAAVVNMVKNGLNIMALSVGDGANDVAMIQEADVGVGIAGEEGRQAVMSSDYAIGQFRYLQRLLLVHGRWSYRR
LGECTANFFYKNLVWTFALFWYCIYNDFDCSYLFDYTYIILVNLAFTSLPVIFMGIFDQDVDDKVSLAVPQLYMR
GIERKEWSQLKFWLYMADGMYQSIICFFMPYLLFAPANFVNETGRNINDRARIGVLVASCAVIASNIYIMMNTYR
WDWFTSLINAISSILIFVWTGIYTSFTSSGQFYHSAAEVYGSLSYWVVLLMTVVVCLLPRFTYNSIQKVFFPLDV
DIIREQVTMGKFKYLDAIEDPPMPPKEGGPKAVAPSDESATSSEIVKPVQPAIKQDTDEERPFYAASVAPTANTH
NPRSQNSSNGTNYTASLDHDPRPQSVDYVRRSPDRTRHSFDRSRPSFEQSNDFTSAAMLSRVESSQTPHRQHEDP
FRTADDPPVHNVI*
Coding >Pro_DTO377G3_2|g4346.t1
ATGGCTTCCGCGCGCTTCCCTGGAGACAATGGAGAGGATGAAGGGGACAACAACGAGCAAGGTGCTGATATCGGG
GAGGTCAACAGCCACGTCTCCAAGCCGACTAAACGACAAAGATGGGCTACCACACGAGCGCCCGGACATGGTGGC
GTCAAGAAACGTGTTTCAATTATCGATCGCTTCCATAAACGGTCAGATCTGAAAGACGAAAAGCGAAAATCGAAC
AATACAAGCACCTCAGGCAATAGCGAATCTCAGATCCCGCAAGAAGGACCGAATCGGAGAATCTACTTCAGCATT
CCTATTCCGGAATCCGAACGAGACGAGGATGGTCATTTGCGCATCACGTACCCCAGAAACAAAATTCGCACGGCC
AAGTATACACCGCTCACCTTTGTTCCCTACAACATCTGGCTACAATTTCACAACATCGCGAACATCTATTTCTTG
TTCGTCATCATTCTTAATTGCTTTCCAATTTTCGGCGCCAACAACCCCGGTCTGAACGCCGTTCCTCTAATCGTT
ATTATCGTTGTGACCGCTATCAAAGATGCCATTGAGGATTGGGGGAGAACAGTGTCTGACAATCAAGTGAACAAC
TCTCCGGTTTACAGACTGGTTGAATGGAACAATGTCAATTCGACAGAAGACAACATTGATATATGGCGTCGTGTC
AAGAAGGCTTGTACCAGGGGCTCGATCGCCTCATATAAGTGGGTTGTTTCTCAATTTAAGAAGAAAGAGAAAGAG
GGGGATGATGATGAAGGGCAAAGACGCGACTCATTCTTGAGTACAGCAGATCGCCGGTCCTCGATTTATACGCAG
CGGAACTCCTTAGCCCCCGAAGATATCGCTATCCCCATGACCGATGTTCCATCGCCTCAGCCCGAAGCTCGCGAA
GATTGGCCGATCGTGAGCAACCCTGAAAACAAGTATCTGTCTCCGAACAGCGCAGCTCGACAGAGCGTCGTTGAG
CCAACGCCGGACAAGAAACATGGAACCATCCTGGACATGTCCAAGCAGACACCCGGCAAGGCCCGATTCAAGCGA
GAGCAGTGGAAAAGTCTGCAAGTTGGCGACTTTGTCCGGTTGTACAACGAGGATCCTATTCCAGCCGATGTCGTG
ATTCTGTCCACTTCTGACCCGGATGGCGCATGTTATGTCGAAACAAAAGGCTTGGATGGAGAAACCAATTTGAAG
GTTCGCCAAGCTCTTCACTGTGGCCATGAAGTTCGACACGCCAGAGACTGCGAAAAGGCCGAGTTTGTGATCGAA
AGTGAGGCCCCGCATGCCAACCTGTACACTTACAATGGTGCCATACGTTGGGACCAGCGCGATCCACGTTTCCCT
GAAGCTCCCCGGAAGGAGATGGTTGAGCCCATCTCTATCAACAACATCTTGCTCCGTGGGTGCAATTTGAAGAGT
ACCGAATGGGTCCTAGGTGTTGTCCTCTTCACCGGTGGAGAGAGCAAGATCATGCTCAATTCCGGTGCGACTCCG
GCAAAACGACCTCGCATGGCAAAGGATCTGAATTGGAACGTCATTTACAACTTTTTCATCCTATTCCTCATGTGT
ATTGTCGCAGGTATTGTGAATGGAATCGCATGGGCCAGGCCAGACAAATCTCTAGACTACTTTGATCTTGAGTCC
TACGGAGGCACACCACCTGTCACTGGTATTGTCACCTTTTGGACCGCTCTCATCCTGTTCCAAAACTTGGTTCCC
ATTTCGCTTTATATTTCTCTTGAAATTGTTCGGACCATCCAAGCGCTTTTCATCAACAACGATCTGTTCATGTAC
TACGAGAGACTGGGGATCTATTGTGTCCCTAAGTCTTGGAACATTTCAGACGACGTTGGCCAAGTCGAGTACATT
TTTTCTGACAAAACTGGTACATTGACTCAAAATCTGATGGAGTTCAAGAAGTGTACGGTCAACGGTTTGGCATAT
GGAGAGGCTTACACAGAAGCTCAGGTTGGCATGCGGCGTCGCGAGGGAGCTGATGCTGACGCAGAGGCCGCAGTG
GCTCGACAACAAATTGCTGCCGATGCGCAGAAAATGTTGGGTCTGTTGCGTGGGATTCATGACAACCCTTACCTG
CACGACGACCAACTGACGTTCGTTGCTCCGAATTTTGTGGCCGATTTGACAGGACAATCCGGAGAGCGGCAGAAG
CACTGTACAGAGGACTTCATGCTGGCTCTTGCCTTGTGTCATACCGTTATCACCGAGCATACTCCCGGCGACCCC
CCTCAAATTGAGTTTAAGGCCCAGTCTCCTGACGAGGCAGCGTTGGTCAGCACTGCTCGAGATTGTGGATTCACC
GTTTTGGGCCGAGCCGGTGACGATCTTCTCCTGAATGTCATGGGCGAGGAACGCACATATACAGTTTTGAACACC
CTTGAATTCAACTCATCTAGAAAACGAATGAGTGCAATTATCCGAATGCCCGATGGTACTATACGCCTCTTCTGC
AAGGGTGCGGACAGTATAATTTACTCCCGTCTAGCCCGTGGCAAACAACAGGAGCTCCGCCGACAGACTGCAGAG
CACTTGGAGGAGTTCGCTAGGGAAGGACTTCGAACTTTGTGCGTTGCCGATCGACTGCTTAGTGAGGATGAATAC
TACACATGGGCTAAGGAACACGATATCGCTGCCGCTGCGATCACAGACCGTGAGGAGAAACTAGAGATGGTTTCT
AGTCAAATCGAACAGGAGCTCATGCTTATTGGTGGAACTGCCATTGAGGACAGACTTCAGGATGGTGTGCCCGAT
ACAATCCAGCTTCTTGCGGACGCTGGTATCAAACTCTGGGTTCTTACCGGTGACAAGGTTGAGACCGCCATCAAC
ATTGGGTTTTCTTGCAACCTACTCAATAACAACATGGAGCTGATTGTGCTGAACATTCCCGAGACTGAACACCAG
CAGGCCTCTGACGAACTCGACAAGAATTTGCAAACTTTCGGATTGACCGGTTCTGACGAGGAACTTATTGCTGCT
CGTGCTGATCATACACCACCCGAGGCTACACATGCCGTGGTCGTTGATGGTGAAACCCTGAAGCTGATGCTCTCC
GATGACTTAAAGCAAAAATTCCTCCTACTCTGCAAGCAGTGCAAGGCCGTTCTTTGCTGCCGTGTCAGCCCCGCA
CAGAAAGCCGCCGTCGTGAACATGGTCAAGAACGGGCTGAACATCATGGCTCTTTCCGTTGGTGATGGTGCCAAC
GATGTGGCTATGATTCAAGAGGCCGACGTTGGTGTCGGTATTGCTGGCGAAGAAGGTAGACAAGCTGTCATGTCA
TCCGATTATGCAATTGGTCAGTTCCGGTACCTCCAGCGCCTTCTTTTGGTGCATGGGAGATGGTCTTACCGTCGC
CTCGGAGAGTGCACGGCCAACTTCTTTTATAAGAATCTCGTGTGGACGTTCGCCCTTTTCTGGTACTGTATCTAC
AACGACTTCGATTGCTCCTACCTCTTCGACTATACCTACATTATCTTGGTCAACCTCGCTTTCACTTCATTGCCT
GTAATCTTCATGGGTATCTTCGATCAGGATGTGGACGACAAGGTGTCTCTTGCTGTCCCTCAACTGTACATGAGA
GGTATCGAGCGTAAGGAATGGTCGCAACTTAAGTTCTGGTTGTACATGGCCGATGGCATGTACCAGTCAATTATT
TGTTTCTTCATGCCTTACCTCCTATTCGCGCCAGCAAACTTCGTCAACGAAACTGGACGCAATATCAATGACCGA
GCCCGTATCGGAGTTCTAGTCGCGTCCTGTGCGGTGATTGCTAGTAATATCTACATTATGATGAATACTTACCGA
TGGGATTGGTTCACGTCTCTGATCAACGCCATCAGTAGCATTCTCATCTTTGTGTGGACCGGCATTTATACCTCC
TTCACTTCCTCTGGTCAATTCTACCATTCCGCTGCTGAAGTTTACGGCTCGTTGAGTTACTGGGTCGTCCTCCTG
ATGACTGTCGTGGTTTGCTTGCTTCCGCGTTTCACGTACAACTCCATCCAGAAGGTGTTCTTCCCGCTTGATGTC
GATATCATCCGCGAGCAAGTGACTATGGGCAAATTCAAGTATCTGGACGCCATAGAAGATCCCCCAATGCCCCCG
AAAGAGGGAGGCCCGAAGGCCGTGGCTCCCAGTGATGAATCGGCTACCTCTTCGGAAATAGTGAAGCCAGTGCAG
CCCGCCATCAAGCAGGACACTGATGAAGAGCGGCCCTTCTATGCTGCATCCGTGGCCCCGACCGCAAACACCCAC
AACCCCCGCAGTCAAAACAGCAGTAATGGGACCAACTACACCGCCAGTCTTGACCATGATCCGCGACCACAGTCC
GTGGACTATGTTCGCCGATCTCCCGACCGGACACGGCATTCGTTTGACCGGAGTCGACCGAGCTTCGAGCAAAGC
AACGACTTCACTTCCGCTGCCATGCTTTCTCGGGTGGAATCTTCGCAAACTCCACACCGTCAACATGAGGACCCA
TTCCGGACTGCTGACGATCCTCCTGTACATAATGTGATATAG
Transcript >Pro_DTO377G3_2|g4346.t1
ATGGCTTCCGCGCGCTTCCCTGGAGACAATGGAGAGGATGAAGGGGACAACAACGAGCAAGGTGCTGATATCGGG
GAGGTCAACAGCCACGTCTCCAAGCCGACTAAACGACAAAGATGGGCTACCACACGAGCGCCCGGACATGGTGGC
GTCAAGAAACGTGTTTCAATTATCGATCGCTTCCATAAACGGTCAGATCTGAAAGACGAAAAGCGAAAATCGAAC
AATACAAGCACCTCAGGCAATAGCGAATCTCAGATCCCGCAAGAAGGACCGAATCGGAGAATCTACTTCAGCATT
CCTATTCCGGAATCCGAACGAGACGAGGATGGTCATTTGCGCATCACGTACCCCAGAAACAAAATTCGCACGGCC
AAGTATACACCGCTCACCTTTGTTCCCTACAACATCTGGCTACAATTTCACAACATCGCGAACATCTATTTCTTG
TTCGTCATCATTCTTAATTGCTTTCCAATTTTCGGCGCCAACAACCCCGGTCTGAACGCCGTTCCTCTAATCGTT
ATTATCGTTGTGACCGCTATCAAAGATGCCATTGAGGATTGGGGGAGAACAGTGTCTGACAATCAAGTGAACAAC
TCTCCGGTTTACAGACTGGTTGAATGGAACAATGTCAATTCGACAGAAGACAACATTGATATATGGCGTCGTGTC
AAGAAGGCTTGTACCAGGGGCTCGATCGCCTCATATAAGTGGGTTGTTTCTCAATTTAAGAAGAAAGAGAAAGAG
GGGGATGATGATGAAGGGCAAAGACGCGACTCATTCTTGAGTACAGCAGATCGCCGGTCCTCGATTTATACGCAG
CGGAACTCCTTAGCCCCCGAAGATATCGCTATCCCCATGACCGATGTTCCATCGCCTCAGCCCGAAGCTCGCGAA
GATTGGCCGATCGTGAGCAACCCTGAAAACAAGTATCTGTCTCCGAACAGCGCAGCTCGACAGAGCGTCGTTGAG
CCAACGCCGGACAAGAAACATGGAACCATCCTGGACATGTCCAAGCAGACACCCGGCAAGGCCCGATTCAAGCGA
GAGCAGTGGAAAAGTCTGCAAGTTGGCGACTTTGTCCGGTTGTACAACGAGGATCCTATTCCAGCCGATGTCGTG
ATTCTGTCCACTTCTGACCCGGATGGCGCATGTTATGTCGAAACAAAAGGCTTGGATGGAGAAACCAATTTGAAG
GTTCGCCAAGCTCTTCACTGTGGCCATGAAGTTCGACACGCCAGAGACTGCGAAAAGGCCGAGTTTGTGATCGAA
AGTGAGGCCCCGCATGCCAACCTGTACACTTACAATGGTGCCATACGTTGGGACCAGCGCGATCCACGTTTCCCT
GAAGCTCCCCGGAAGGAGATGGTTGAGCCCATCTCTATCAACAACATCTTGCTCCGTGGGTGCAATTTGAAGAGT
ACCGAATGGGTCCTAGGTGTTGTCCTCTTCACCGGTGGAGAGAGCAAGATCATGCTCAATTCCGGTGCGACTCCG
GCAAAACGACCTCGCATGGCAAAGGATCTGAATTGGAACGTCATTTACAACTTTTTCATCCTATTCCTCATGTGT
ATTGTCGCAGGTATTGTGAATGGAATCGCATGGGCCAGGCCAGACAAATCTCTAGACTACTTTGATCTTGAGTCC
TACGGAGGCACACCACCTGTCACTGGTATTGTCACCTTTTGGACCGCTCTCATCCTGTTCCAAAACTTGGTTCCC
ATTTCGCTTTATATTTCTCTTGAAATTGTTCGGACCATCCAAGCGCTTTTCATCAACAACGATCTGTTCATGTAC
TACGAGAGACTGGGGATCTATTGTGTCCCTAAGTCTTGGAACATTTCAGACGACGTTGGCCAAGTCGAGTACATT
TTTTCTGACAAAACTGGTACATTGACTCAAAATCTGATGGAGTTCAAGAAGTGTACGGTCAACGGTTTGGCATAT
GGAGAGGCTTACACAGAAGCTCAGGTTGGCATGCGGCGTCGCGAGGGAGCTGATGCTGACGCAGAGGCCGCAGTG
GCTCGACAACAAATTGCTGCCGATGCGCAGAAAATGTTGGGTCTGTTGCGTGGGATTCATGACAACCCTTACCTG
CACGACGACCAACTGACGTTCGTTGCTCCGAATTTTGTGGCCGATTTGACAGGACAATCCGGAGAGCGGCAGAAG
CACTGTACAGAGGACTTCATGCTGGCTCTTGCCTTGTGTCATACCGTTATCACCGAGCATACTCCCGGCGACCCC
CCTCAAATTGAGTTTAAGGCCCAGTCTCCTGACGAGGCAGCGTTGGTCAGCACTGCTCGAGATTGTGGATTCACC
GTTTTGGGCCGAGCCGGTGACGATCTTCTCCTGAATGTCATGGGCGAGGAACGCACATATACAGTTTTGAACACC
CTTGAATTCAACTCATCTAGAAAACGAATGAGTGCAATTATCCGAATGCCCGATGGTACTATACGCCTCTTCTGC
AAGGGTGCGGACAGTATAATTTACTCCCGTCTAGCCCGTGGCAAACAACAGGAGCTCCGCCGACAGACTGCAGAG
CACTTGGAGGAGTTCGCTAGGGAAGGACTTCGAACTTTGTGCGTTGCCGATCGACTGCTTAGTGAGGATGAATAC
TACACATGGGCTAAGGAACACGATATCGCTGCCGCTGCGATCACAGACCGTGAGGAGAAACTAGAGATGGTTTCT
AGTCAAATCGAACAGGAGCTCATGCTTATTGGTGGAACTGCCATTGAGGACAGACTTCAGGATGGTGTGCCCGAT
ACAATCCAGCTTCTTGCGGACGCTGGTATCAAACTCTGGGTTCTTACCGGTGACAAGGTTGAGACCGCCATCAAC
ATTGGGTTTTCTTGCAACCTACTCAATAACAACATGGAGCTGATTGTGCTGAACATTCCCGAGACTGAACACCAG
CAGGCCTCTGACGAACTCGACAAGAATTTGCAAACTTTCGGATTGACCGGTTCTGACGAGGAACTTATTGCTGCT
CGTGCTGATCATACACCACCCGAGGCTACACATGCCGTGGTCGTTGATGGTGAAACCCTGAAGCTGATGCTCTCC
GATGACTTAAAGCAAAAATTCCTCCTACTCTGCAAGCAGTGCAAGGCCGTTCTTTGCTGCCGTGTCAGCCCCGCA
CAGAAAGCCGCCGTCGTGAACATGGTCAAGAACGGGCTGAACATCATGGCTCTTTCCGTTGGTGATGGTGCCAAC
GATGTGGCTATGATTCAAGAGGCCGACGTTGGTGTCGGTATTGCTGGCGAAGAAGGTAGACAAGCTGTCATGTCA
TCCGATTATGCAATTGGTCAGTTCCGGTACCTCCAGCGCCTTCTTTTGGTGCATGGGAGATGGTCTTACCGTCGC
CTCGGAGAGTGCACGGCCAACTTCTTTTATAAGAATCTCGTGTGGACGTTCGCCCTTTTCTGGTACTGTATCTAC
AACGACTTCGATTGCTCCTACCTCTTCGACTATACCTACATTATCTTGGTCAACCTCGCTTTCACTTCATTGCCT
GTAATCTTCATGGGTATCTTCGATCAGGATGTGGACGACAAGGTGTCTCTTGCTGTCCCTCAACTGTACATGAGA
GGTATCGAGCGTAAGGAATGGTCGCAACTTAAGTTCTGGTTGTACATGGCCGATGGCATGTACCAGTCAATTATT
TGTTTCTTCATGCCTTACCTCCTATTCGCGCCAGCAAACTTCGTCAACGAAACTGGACGCAATATCAATGACCGA
GCCCGTATCGGAGTTCTAGTCGCGTCCTGTGCGGTGATTGCTAGTAATATCTACATTATGATGAATACTTACCGA
TGGGATTGGTTCACGTCTCTGATCAACGCCATCAGTAGCATTCTCATCTTTGTGTGGACCGGCATTTATACCTCC
TTCACTTCCTCTGGTCAATTCTACCATTCCGCTGCTGAAGTTTACGGCTCGTTGAGTTACTGGGTCGTCCTCCTG
ATGACTGTCGTGGTTTGCTTGCTTCCGCGTTTCACGTACAACTCCATCCAGAAGGTGTTCTTCCCGCTTGATGTC
GATATCATCCGCGAGCAAGTGACTATGGGCAAATTCAAGTATCTGGACGCCATAGAAGATCCCCCAATGCCCCCG
AAAGAGGGAGGCCCGAAGGCCGTGGCTCCCAGTGATGAATCGGCTACCTCTTCGGAAATAGTGAAGCCAGTGCAG
CCCGCCATCAAGCAGGACACTGATGAAGAGCGGCCCTTCTATGCTGCATCCGTGGCCCCGACCGCAAACACCCAC
AACCCCCGCAGTCAAAACAGCAGTAATGGGACCAACTACACCGCCAGTCTTGACCATGATCCGCGACCACAGTCC
GTGGACTATGTTCGCCGATCTCCCGACCGGACACGGCATTCGTTTGACCGGAGTCGACCGAGCTTCGAGCAAAGC
AACGACTTCACTTCCGCTGCCATGCTTTCTCGGGTGGAATCTTCGCAAACTCCACACCGTCAACATGAGGACCCA
TTCCGGACTGCTGACGATCCTCCTGTACATAATGTGATATAG
Gene >Pro_DTO377G3_2|g4346.t1
ATGGCTTCCGCGCGCTTCCCTGGAGACAATGGAGAGGATGAAGGGGACAACAACGAGCAAGGTGCTGATATCGGG
GAGGTCAACAGCCACGTCTCCAAGCCGACTAAACGACAAAGATGGGCTACCACACGAGCGCCCGGACATGGTGGC
GTCAAGAAACGTGTTTCAATTATCGATCGCTTCCATAAACGGTCAGATCTGAAAGACGAAAAGCGAAAATCGAAC
AATACAAGCACCTCAGGCAATAGCGAATCTCAGATCCCGCAAGAAGGACCGAATCGGAGAATCTACTTCAGCATT
CCTATTCCGGAATCCGAACGAGACGAGGATGGTCATTTGCGCATCACGTACCCCAGAAACAAAATTCGCACGGCC
AAGTATACACCGCTCACCTTTGTTCCCTACAACATCTGGCTACAATTTCACAACATCGCGAACATCTATTTCTTG
TTCGTCATCATTCTTAATGTACGCAGTGATATCCTTATTTCCATGGCTTCCACCCCAGTTGGCATTGGCTGATGA
TATTCTAGTGCTTTCCAATTTTCGGCGCCAACAACCCCGGTCTGAACGCCGTTCCTCTAATCGTTATTATCGTTG
TGACCGCTATCAAAGATGCCATTGAGGATTGGGGGAGAACAGTGTCTGACAATCAAGTGAACAACTCTCCGGTTT
ACAGACTGGTTGAATGGAACAATGTCAATTCGACAGAAGACAACATTGATATATGGCGTCGTGTCAAGAAGGCTT
GTACCAGGGGCTCGATCGCCTCATATAAGTGGGTTGTTTCTCAATTTAAGAAGAAAGAGAAAGAGGGGGATGATG
ATGAAGGGCAAAGACGCGACTCATTCTTGAGTACAGCAGATCGCCGGTCCTCGATTTATACGCAGCGGAACTCCT
TAGCCCCCGAAGATATCGCTATCCCCATGACCGATGTTCCATCGCCTCAGCCCGAAGCTCGCGAAGATTGGCCGA
TCGTGAGCAACCCTGAAAACAAGTATCTGTCTCCGAACAGCGCAGCTCGACAGAGCGTCGTTGAGCCAACGCCGG
ACAAGAAACATGGAACCATCCTGGACATGTCCAAGCAGACACCCGGCAAGGCCCGATTCAAGCGAGAGCAGTGGA
AAAGTCTGCAAGTTGGCGACTTTGTCCGGTTGTACAACGAGGATCCTATTCCAGCCGATGTCGTGATTCTGTCCA
CTTCTGACCCGGATGGCGCATGTTATGTCGAAACAAAAGGCTTGGATGGAGAAACCAATTTGAAGGTTCGCCAAG
CTCTTCACTGTGGCCATGAAGTTCGACACGCCAGAGACTGCGAAAAGGCCGAGTTTGTGATCGAAAGTGAGGCCC
CGCATGCCAACCTGTACACTTACAATGGTGCCATACGTTGGGACCAGCGCGATCCACGTTTCCCTGAAGCTCCCC
GGAAGGAGATGGTTGAGCCCATCTCTATCAACAACATCTTGCTCCGTGGGTGCAATTTGAAGAGTACCGAATGGG
TCCTAGGTGTTGTCCTCTTCACCGGTGGAGAGAGCAAGATCATGCTCAATTCCGGTGCGACTCCGGCAAAACGAC
CTCGCATGGCAAAGGATCTGAATTGGAACGTCATTTACAACTTTTTCATCCTATTCCTCATGTGTATTGTCGCAG
GTATTGTGAATGGAATCGCATGGGCCAGGCCAGACAAATCTCTAGACTACTTTGATCTTGAGTCCTACGGAGGCA
CACCACCTGTCACTGGTATTGTCACCTTTTGGACCGCTCTCATCCTGTTCCAAAACTTGGTTCCCATTTCGCTTT
ATATTTCTCTTGAAATTGTTCGGACCATCCAAGCGCTTTTCATCAACAACGATCTGTTCATGTACTACGAGAGAC
TGGGGATCTATTGTGTCCCTAAGTCTTGGAACATTTCAGACGACGTTGGCCAAGTCGAGTACATTTTTTCTGACA
AAACTGGTACATTGACTCAAAATCTGATGGAGTTCAAGAAGTGTACGGTCAACGGTTTGGCATATGGAGAGGCTT
ACACAGAAGCTCAGGTTGGCATGCGGCGTCGCGAGGGAGCTGATGCTGACGCAGAGGCCGCAGTGGCTCGACAAC
AAATTGCTGCCGATGCGCAGAAAATGTTGGGTCTGTTGCGTGGGATTCATGACAACCCTTACCTGCACGACGACC
AACTGACGTTCGTTGCTCCGAATTTTGTGGCCGATTTGACAGGACAATCCGGAGAGCGGCAGAAGCACTGTACAG
AGGACTTCATGCTGGCTCTTGCCTTGTGTCATACCGTTATCACCGAGCATACTCCCGGCGACCCCCCTCAAATTG
AGTTTAAGGCCCAGTCTCCTGACGAGGCAGCGTTGGTCAGCACTGCTCGAGATTGTGGATTCACCGTTTTGGGCC
GAGCCGGTGACGATCTTCTCCTGAATGTCATGGGCGAGGAACGCACATATACAGTTTTGAACACCCTTGAATTCA
ACTCATCTAGAAAACGAATGAGTGCAATTATCCGAATGCCCGATGGTACTATACGCCTCTTCTGCAAGGGTGCGG
ACAGTATAATTTACTCCCGTCTAGCCCGTGGCAAACAACAGGAGCTCCGCCGACAGACTGCAGAGCACTTGGAGG
AGTTCGCTAGGGAAGGACTTCGAACTTTGTGCGTTGCCGATCGACTGCTTAGTGAGGATGAATACTACACATGGG
CTAAGGAACACGATATCGCTGCCGCTGCGATCACAGACCGTGAGGAGAAACTAGAGATGGTTTCTAGTCAAATCG
AACAGGAGCTCATGCTTATTGGTGGAACTGCCATTGAGGACAGACTTCAGGATGGTGTGCCCGATACAATCCAGC
TTCTTGCGGACGCTGGTATCAAACTCTGGGTTCTTACCGGTGACAAGGTTGAGACCGCCATCAACATTGGGTTTT
CTTGCAACCTACTCAATAACAACATGGAGCTGATTGTGCTGAACATTCCCGAGACTGAACACCAGCAGGCCTCTG
ACGAACTCGACAAGAATTTGCAAACTTTCGGATTGACCGGTTCTGACGAGGAACTTATTGCTGCTCGTGCTGATC
ATACACCACCCGAGGCTACACATGCCGTGGTCGTTGATGGTGAAACCCTGAAGCTGATGCTCTCCGATGACTTAA
AGCAAAAATTCCTCCTACTCTGCAAGCAGTGCAAGGCCGTTCTTTGCTGCCGTGTCAGCCCCGCACAGAAAGCCG
CCGTCGTGAACATGGTCAAGAACGGGCTGAACATCATGGCTCTTTCCGTTGGTGATGGTGCCAACGATGTGGCTA
TGATTCAAGAGGCCGACGTTGGTGTCGGTATTGCTGGCGAAGAAGGTAGACAAGCTGTCATGTCATCCGATTATG
CAATTGGTCAGTTCCGGTACCTCCAGCGCCTTCTTTTGGTGCATGGGAGATGGTCTTACCGTCGCCTCGGAGAGT
GCACGGCCAACTTCTTTTATAAGGTATGTGGCGTTGGTATTGACTATTATTCTGTATTACCACTGACTCCTCCCA
GAATCTCGTGTGGACGTTCGCCCTTTTCTGGTACTGTATCTACAACGACTTCGATTGCTCCTACCTCTTCGACTA
TACCTACATTATCTTGGTCAACCTCGCTTTCACTTCATTGCCTGTAATCTTCATGGGTATCTTCGATCAGGATGT
GGACGACAAGGTGTCTCTTGCTGTCCCTCAACTGTACATGAGAGGTATCGAGCGTAAGGAATGGTCGCAACTTAA
GTTCTGGTACTTTGAATCCTCCCCCAAACTCTTGAGATGTTTCGAGACATACTAACTTGGACAGGTTGTACATGG
CCGATGGCATGTACCAGTCAATTATTTGTTTCTTCATGCCTTACCTCCTATTCGCGCCAGCAAACTTCGTCAACG
AAACTGGACGCAATATCAATGACCGAGCCCGTATCGGAGTTCTAGTCGCGTCCTGTGCGGTGATTGCTAGTAATA
TCTACATTATGATGAATACTTACCGATGGGATTGGTTCACGTCTCTGATCAACGCCATCAGTAGCATTCTCATCT
TTGTGTGGACCGGCATTTATACCTCCTTCACTTCCTCTGGTCAATTCTACCATTCCGCTGCTGAAGTTTACGGCT
CGTTGAGTTACTGGGTCGTCCTCCTGATGACTGTCGTGGTTTGCTTGCTTCCGCGTTTCACGTACAACTCCATCC
AGAAGGTGTTCTTCCCGCTTGATGTCGATATCATCCGCGAGCAAGTGACTATGGGCAAATTCAAGTATCTGGACG
CCATAGAAGATCCCCCAATGCCCCCGAAAGAGGGAGGCCCGAAGGCCGTGGCTCCCAGTGATGAATCGGCTACCT
CTTCGGAAATAGTGAAGCCAGTGCAGCCCGCCATCAAGCAGGACACTGATGAAGAGCGGCCCTTCTATGCTGCAT
CCGTGGCCCCGACCGCAAACACCCACAACCCCCGCAGTCAAAACAGCAGTAATGGGACCAACTACACCGCCAGTC
TTGACCATGATCCGCGACCACAGTCCGTGGACTATGTTCGCCGATCTCCCGACCGGACACGGCATTCGTTTGACC
GGAGTCGACCGAGCTTCGAGCAAAGCAACGACTTCACTTCCGCTGCCATGCTTTCTCGGGTGGAATCTTCGCAAA
CTCCACACCGTCAACATGAGGACCCATTCCGGACTGCTGACGATCCTCCTGTACATAATGTGATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail