Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4345.t1
Gene name
Locationscaffold_09:287..6951
Strand-
Gene length (bp)6664
Transcript length (bp)6480
Coding sequence length (bp)6480
Protein length (aa) 2160

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12726 SEN1_N SEN1 N terminal 9.7E-208 83 797
PF13086 AAA_11 AAA domain 3.7E-75 1305 1588
PF13087 AAA_12 AAA domain 6.1E-62 1595 1790
PF13245 AAA_19 AAA domain 2.9E-07 1309 1583

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4345.t1
MEFLAAIRELKALPETTHLFCPRKDNDDHGRYEDLEQVDESGKAVKDIVAEATARRESFLSSMRILAYHKDGVED
DQNWILGKLDESLEKCDLCIKHYYIGKIWLMDLLKEENYHEDDIEAFAQRIDEWDIRRITRNLTTATTQLKQIPL
EKISLDVLDRAALLSIFETLSCEAMLRNESLLQEYFDEPFKLIQTKRSLKVSDYIPAVSRFLFDSNQFRSFWAVQ
SWTRYSRPPTNQEFDWAVRDGLLMGLRAASQQPPQFAVIQRLWRGMQLVVRKLDKEQITHQLRGLEIDPCRLSVD
HLAIPAPSLRFLLNTIQLFLEKAPVDFWDAMQTISPQAIMEQAFYNTQFNAFLLETSEGEPFEKSALKDMLSWIN
PFLGSLKGAHQPSACRFLILQLLGRLQDTQYPNLSRYHCFDIGLASLLQTLRRFTENESSRGTVTRIVLAETMGV
VGDTIDAIISPPTFDVERSRQNGILTQCMEVVRNTLALECQSLKTDYEALLKHGTLSHGVSTYSAPIWDAVIKHL
HRDNLPLSSSALLGILPLVGLEMFPTKGEGNKEKTHFNMIYGHLTNLSCRIIERLADFPPEHLETLFQSQDTSSA
VISALFAADYDTYTAAVDLIKAVSGQSARRDAISHLLQSSFTTTIYGLSWSFRRISHMKTFAPAPRMLYTGTDIV
EILCDSQTGMLRTRNLADRREVVSLQKLWEYLWLALTTIFDETEAWHLRGNDKAVMLEFCRDTIQFADLLFDQYG
VFLGAVGNADPGQTSASENFLKSPTATMSAMVKWLRLKDEFLATTLVGLVAKLLRRLGGMNVTTVKPDALSFIEG
VAVNGTIKTILNQREKAELVRSLEAYYKKPVVTASTAALKKQSSITAFAKPSASSPSSRITSDDDFDDDTLNDQT
LLELSSSVEFNKARLATQAKRAAEKATKMHSSTALKNRPDIFPPRMFPKSVPPLRSNNDPTHVLSFREKRERERE
AKKKRDQIELARLKKNTTAYGVGEQTAEQGSGLKGIGIKGKDHTTPADSMMVSSGDESDSESEDELDKELFGAKP
KKPDAVAAYELSKKQSLQQQPIKKVKRHRSVRDMRARLAPDLSSLHRSILSWDFFATGDLPPSSDRTDYSLVSNT
FRTPDAYQSTFEPLLILEAWQGFQQAKDEGSFRPFEVKVMTRLAVDSWIEFSTQPLGVLPKDFSMGEGDLVMFSS
SPKLTSDPSAPHVLARVCGVNRKNKKMEVTYRVNPGSNKFLSSLGPGTEAWGAKITSLIPVEREYGALMALQYYD
LCEEIVLAKPSPLLTYSDARLQPIMDNYSINRAQAKAIKSAVDNDAFTLIQGPPGSGKTKTIIALVGSLLSDVLG
KQVIKVNGAPVARNSLSKKLLLCAPSNAAVDELVMRLKDGVRTTHGRQEKVSVLRLGRSDAINTNVLDVTLDEMV
NARLNQDPSKGNGVDLQKLYEEHKTTDTSFKELRGRLDEARAKGLPPPEELEREFHLMKKKRSQLSTSIDKARDQ
NHTLARNADMHKRRIQEQIINEAHVICTTLSGSGHEIFQGMNVEFETVIIDEAAQCIELSALIPLKYGCSKCVLV
GDPKQLPPTVLSKMASKFQYEQSLFVRMQKNHPRDVHLLDIQYRMHPAISHFPSVTFYDGKLQDGPDMAKLRQRP
WHQSELLSPYRFFDVQGMHSSAARGHSLINYAELQVAMQLYDRLITDVKEYDFAGKIGIITPYKGQLRELKNQFT
QRYGEDILKKVDFNTTDAFQGRESEIIIFSCVRASNKGIGFLADIRRMNVGLTRAKSSLWVLGNSQSLEQGQFWS
RLIQNARERNVYTEGDIVKILEKPQFTGYKEIEMVDLDTAEAPGSPDYEPPVPPISRPSSASVSVSASGHGTSPI
PQPDGPSGGAKGLDPTKMCGICGSANHFTYNCDNDEAKANARGTCFRCGQPGHTKISCRAERCVECGECGHSSRN
CTSTKVLSKIEKSRLERDEYILKQRQDSSTERQRERQLGGHNPKIPVVRATNSTAPINTLDNSAKRKREESSSNG
PQAQRPRTGQPHPPIHVPKGSLGSNHPGLSGPAARGSNVPRVSGHPGLSGPPRDNLVANTQNGYKGPLANGSPGG
LIKPSRDGQAYPTENDPTRAPPMRSGADVPNQAAPKPRPPIMRKKKATDPFIRPKPKRK*
Coding >Pro_DTO377G3_2|g4345.t1
ATGGAGTTTCTGGCTGCGATTAGAGAACTCAAGGCCCTCCCGGAGACCACCCACCTCTTCTGTCCCCGGAAAGAC
AACGATGATCATGGACGCTACGAAGATTTAGAGCAAGTGGACGAATCAGGAAAGGCCGTCAAGGATATCGTAGCT
GAAGCAACGGCTCGAAGAGAGAGTTTTCTCTCGTCCATGCGCATCCTGGCATACCATAAGGATGGCGTGGAAGAC
GATCAGAACTGGATCCTGGGAAAACTAGACGAATCTCTGGAGAAATGTGATCTATGCATTAAGCATTATTACATC
GGCAAAATCTGGCTCATGGACCTGCTCAAGGAGGAGAACTATCACGAAGATGATATTGAGGCGTTTGCCCAGAGA
ATCGATGAGTGGGACATTCGGAGAATCACTCGTAACTTGACAACCGCCACGACCCAGTTGAAACAAATCCCATTG
GAGAAAATTAGCTTGGATGTCTTGGACAGGGCTGCATTGCTGTCAATCTTCGAGACCCTGAGCTGTGAAGCCATG
CTGCGCAACGAAAGCCTTTTGCAGGAATATTTTGATGAGCCATTCAAACTCATTCAAACAAAGCGAAGCTTGAAA
GTTTCAGATTATATTCCTGCAGTCTCTCGCTTTCTTTTTGATTCTAATCAATTCCGAAGCTTCTGGGCTGTTCAG
TCATGGACAAGATACTCGCGGCCTCCTACTAATCAAGAATTTGATTGGGCAGTACGCGATGGCTTGCTGATGGGC
CTGCGGGCTGCGTCACAGCAGCCACCTCAATTCGCAGTCATTCAGAGGTTGTGGCGAGGTATGCAGCTTGTTGTC
CGAAAGCTGGACAAAGAGCAGATTACACATCAGCTTCGAGGGTTGGAAATAGACCCTTGTCGTCTCTCCGTGGAT
CATCTCGCCATACCTGCGCCGAGCTTGCGATTCCTTCTCAACACCATCCAACTATTCCTCGAGAAAGCCCCGGTT
GATTTCTGGGATGCTATGCAAACCATCTCTCCCCAAGCAATCATGGAACAGGCATTTTACAACACACAATTCAAT
GCTTTTCTCCTGGAAACCTCTGAGGGTGAGCCCTTTGAGAAATCCGCTTTGAAAGACATGCTCTCCTGGATCAAT
CCCTTCCTCGGCTCACTGAAGGGTGCTCACCAGCCGTCTGCCTGTCGGTTCTTGATATTGCAATTACTTGGCCGT
CTTCAAGATACTCAATATCCCAATCTGTCGCGCTATCACTGCTTTGACATTGGTTTGGCCAGTCTCCTTCAAACA
CTACGCCGCTTCACAGAAAATGAGTCTTCCCGGGGTACAGTAACTCGGATCGTATTGGCAGAGACAATGGGAGTG
GTTGGTGATACAATCGACGCAATCATCAGCCCCCCGACCTTTGATGTTGAGCGAAGTCGGCAGAATGGCATTCTC
ACGCAGTGCATGGAAGTTGTACGCAACACTTTGGCATTGGAGTGTCAATCGTTGAAGACCGACTATGAGGCACTT
CTGAAGCACGGTACGCTCTCACATGGAGTATCTACCTACTCTGCACCCATCTGGGATGCTGTGATCAAGCACCTC
CACCGGGATAACCTGCCGCTGTCAAGTTCGGCCCTCTTAGGAATCTTGCCCCTGGTTGGCTTGGAGATGTTTCCC
ACGAAAGGAGAAGGGAACAAGGAGAAGACCCACTTCAATATGATTTATGGCCATCTCACCAACCTCTCATGTCGA
ATCATCGAGCGTCTCGCGGACTTTCCACCCGAGCACCTTGAAACGTTGTTCCAAAGCCAGGATACTAGTAGCGCC
GTTATTTCGGCTCTGTTTGCCGCCGACTATGACACCTATACAGCTGCGGTTGACTTGATCAAGGCCGTCAGTGGC
CAGTCAGCTCGACGAGATGCCATTTCTCACCTCCTCCAATCTTCGTTCACGACCACAATTTACGGACTCAGTTGG
TCATTCCGTCGGATATCTCACATGAAGACTTTTGCACCCGCCCCAAGAATGCTATACACTGGTACAGACATCGTA
GAGATATTATGTGACAGTCAAACCGGTATGCTGCGAACTCGTAATCTCGCTGATCGCCGGGAGGTTGTGTCGCTG
CAGAAGCTTTGGGAGTATCTGTGGCTGGCACTGACCACGATCTTTGATGAGACCGAGGCATGGCATCTTCGGGGG
AATGATAAGGCTGTCATGCTCGAATTTTGCCGTGACACGATTCAGTTCGCTGACCTTCTTTTTGATCAATATGGT
GTGTTCTTGGGAGCTGTAGGGAATGCGGACCCGGGGCAGACTTCTGCATCCGAAAATTTCCTCAAGTCCCCAACA
GCCACAATGAGTGCTATGGTAAAATGGCTTAGGTTGAAGGATGAGTTCTTGGCAACGACGCTCGTAGGGTTGGTG
GCAAAACTTCTACGCAGATTGGGTGGGATGAATGTGACCACTGTGAAGCCAGATGCATTGAGCTTTATTGAGGGG
GTGGCTGTCAATGGCACAATCAAAACAATACTCAACCAACGTGAGAAGGCAGAATTAGTCCGCTCATTGGAGGCT
TACTATAAGAAACCTGTCGTCACTGCCTCAACTGCTGCTCTCAAGAAACAGTCTTCGATCACCGCTTTTGCCAAA
CCCTCTGCTTCCAGCCCCTCCTCTCGCATCACCAGTGACGATGACTTTGATGATGATACTTTGAACGACCAAACT
CTTCTTGAGCTGTCTTCTTCTGTCGAATTCAACAAGGCTCGCCTCGCAACCCAAGCCAAACGCGCAGCTGAAAAG
GCCACCAAAATGCACTCCTCAACGGCTCTCAAGAATCGTCCGGACATTTTCCCTCCGAGGATGTTTCCCAAGTCA
GTTCCTCCTCTACGATCTAACAATGACCCCACCCACGTCCTATCTTTCCGTGAGAAGCGCGAACGGGAAAGGGAG
GCCAAGAAGAAGCGTGATCAGATTGAGCTCGCCAGACTCAAAAAGAACACGACCGCATATGGTGTTGGGGAGCAA
ACAGCTGAACAAGGCTCTGGCCTGAAAGGTATTGGTATCAAGGGTAAAGATCATACAACCCCTGCAGATAGCATG
ATGGTTTCCTCTGGTGACGAGTCTGATTCTGAGAGCGAAGATGAATTAGACAAGGAACTCTTTGGTGCCAAACCG
AAGAAACCCGACGCCGTCGCGGCCTACGAATTGAGCAAAAAACAATCCCTTCAACAGCAACCCATCAAAAAGGTC
AAGCGCCATCGGTCTGTCAGGGACATGCGGGCTCGCCTGGCTCCAGATCTGAGTTCTCTTCACCGTTCAATCCTC
TCCTGGGACTTTTTCGCAACCGGCGATCTTCCTCCTTCCTCGGATCGCACTGATTATTCCCTGGTCTCAAACACG
TTCCGCACACCCGATGCCTACCAGAGTACATTCGAACCTTTGTTAATTCTTGAAGCGTGGCAAGGTTTTCAACAG
GCGAAGGACGAAGGTTCTTTCCGACCCTTCGAAGTCAAAGTCATGACCCGATTGGCTGTCGACTCGTGGATCGAA
TTCAGCACCCAGCCGCTTGGTGTTCTTCCCAAGGATTTTAGCATGGGCGAAGGTGATTTGGTCATGTTCTCCAGC
TCGCCCAAACTCACAAGCGACCCGAGTGCGCCCCATGTTCTCGCTCGTGTATGCGGTGTCAATCGAAAGAACAAA
AAGATGGAGGTCACATATCGGGTCAATCCTGGGAGTAACAAGTTCCTGTCTTCTTTAGGGCCGGGAACCGAGGCA
TGGGGTGCCAAGATCACTTCTTTGATCCCAGTGGAGCGTGAATATGGTGCCCTAATGGCGTTGCAGTACTATGAT
CTGTGTGAAGAGATTGTCTTGGCTAAGCCTTCACCTCTTCTCACTTATTCGGACGCAAGACTGCAACCCATCATG
GATAATTACTCCATCAATCGTGCTCAGGCAAAAGCCATCAAGTCAGCTGTCGACAACGACGCTTTTACTCTCATC
CAAGGTCCTCCTGGTTCGGGAAAAACCAAAACAATCATCGCGCTTGTCGGAAGTCTTCTAAGCGACGTGCTTGGG
AAACAGGTGATCAAAGTCAACGGTGCCCCTGTTGCGAGAAACTCCCTCTCAAAGAAACTTCTCCTTTGCGCGCCT
AGCAATGCCGCCGTCGACGAGTTAGTCATGCGATTGAAGGATGGTGTGAGGACGACTCATGGTCGGCAAGAAAAG
GTCTCTGTTCTTCGTTTAGGAAGAAGTGACGCAATCAACACCAATGTGTTAGATGTTACCCTTGATGAGATGGTC
AATGCCCGTCTGAATCAGGATCCTAGCAAAGGAAATGGTGTCGACTTGCAGAAGCTCTATGAAGAGCATAAGACG
ACTGATACGTCATTCAAAGAGCTTCGTGGCCGCCTCGATGAGGCACGAGCAAAGGGATTACCTCCTCCGGAAGAG
CTGGAGCGCGAATTTCACTTGATGAAAAAGAAACGGTCCCAATTAAGCACGTCTATTGATAAGGCCCGTGACCAG
AACCATACGCTGGCCCGCAATGCTGATATGCATAAACGGCGGATCCAAGAACAAATCATCAACGAAGCTCATGTC
ATTTGCACTACTCTCAGTGGATCTGGACATGAAATTTTCCAGGGTATGAATGTCGAGTTTGAGACCGTCATCATC
GATGAGGCGGCGCAGTGTATTGAACTCAGTGCTCTTATCCCGCTGAAGTACGGCTGCTCGAAGTGTGTTCTTGTC
GGTGATCCCAAACAGTTGCCTCCAACTGTACTGTCAAAAATGGCGTCCAAGTTCCAGTATGAACAGAGCTTGTTC
GTCCGCATGCAGAAGAATCACCCTCGAGACGTGCATTTGCTGGATATCCAGTACCGTATGCACCCAGCCATCAGT
CATTTCCCCAGTGTGACGTTCTATGATGGCAAGTTGCAGGATGGACCGGACATGGCCAAGCTTCGCCAGCGTCCC
TGGCATCAAAGCGAGCTTCTCAGTCCTTACCGATTTTTTGATGTCCAGGGCATGCACTCATCTGCGGCCAGGGGT
CATTCCTTGATCAATTACGCGGAGTTACAAGTGGCCATGCAACTGTATGATCGTTTGATCACAGATGTCAAAGAA
TACGACTTTGCGGGCAAGATTGGCATCATCACACCTTATAAGGGCCAACTAAGAGAGCTCAAGAACCAATTTACC
CAACGATACGGCGAAGACATTTTGAAGAAGGTCGATTTCAATACGACTGACGCTTTCCAAGGTAGAGAAAGTGAA
ATCATTATCTTCTCCTGTGTGCGAGCATCCAACAAGGGTATTGGTTTCTTGGCTGATATCCGCCGTATGAACGTC
GGTCTCACCCGTGCCAAGTCATCGCTCTGGGTTCTGGGTAACTCGCAGTCCCTAGAACAGGGTCAGTTCTGGAGT
CGGCTCATTCAGAACGCGCGGGAGCGAAATGTCTACACGGAGGGTGATATTGTGAAAATCCTGGAGAAGCCGCAA
TTCACTGGCTACAAAGAGATTGAAATGGTCGACCTTGACACAGCAGAAGCTCCAGGCTCTCCCGACTATGAGCCC
CCTGTACCGCCAATTTCCCGACCTTCGTCGGCCTCCGTCTCAGTGTCTGCCTCTGGCCACGGTACATCCCCAATT
CCACAACCCGATGGACCTTCTGGGGGAGCCAAGGGCTTAGACCCGACGAAAATGTGTGGGATCTGTGGAAGCGCC
AACCATTTTACTTACAACTGCGACAATGACGAAGCAAAGGCAAATGCTCGAGGAACCTGTTTCCGCTGCGGTCAG
CCTGGCCACACTAAGATTTCCTGCCGTGCCGAACGATGCGTTGAATGCGGTGAATGTGGGCACTCATCCCGCAAC
TGCACGTCCACGAAAGTTCTTTCAAAGATCGAGAAATCTCGCCTGGAGAGGGACGAATATATCCTCAAGCAACGT
CAAGATTCATCGACCGAGCGTCAGCGAGAACGTCAACTAGGAGGACACAACCCCAAAATTCCTGTTGTTCGAGCC
ACAAATTCAACCGCGCCAATCAACACTCTTGATAATTCTGCGAAGAGAAAACGTGAAGAATCTTCCTCTAATGGA
CCACAAGCGCAACGTCCTCGTACCGGGCAGCCACATCCCCCAATCCATGTTCCAAAGGGTTCATTGGGTAGTAAT
CATCCCGGTCTATCTGGCCCGGCTGCCCGTGGTTCGAATGTCCCAAGAGTCAGTGGTCACCCGGGTCTTTCTGGT
CCCCCTCGCGACAACCTAGTGGCCAATACTCAAAATGGTTACAAGGGCCCGCTAGCCAATGGCTCACCAGGAGGT
CTCATCAAGCCTTCTCGCGATGGCCAGGCGTATCCGACCGAAAATGACCCGACAAGGGCTCCACCAATGCGATCT
GGAGCAGATGTTCCCAACCAAGCTGCTCCCAAGCCCCGACCTCCAATAATGCGCAAAAAGAAGGCGACAGACCCT
TTCATCCGGCCCAAGCCAAAACGCAAGTAA
Transcript >Pro_DTO377G3_2|g4345.t1
ATGGAGTTTCTGGCTGCGATTAGAGAACTCAAGGCCCTCCCGGAGACCACCCACCTCTTCTGTCCCCGGAAAGAC
AACGATGATCATGGACGCTACGAAGATTTAGAGCAAGTGGACGAATCAGGAAAGGCCGTCAAGGATATCGTAGCT
GAAGCAACGGCTCGAAGAGAGAGTTTTCTCTCGTCCATGCGCATCCTGGCATACCATAAGGATGGCGTGGAAGAC
GATCAGAACTGGATCCTGGGAAAACTAGACGAATCTCTGGAGAAATGTGATCTATGCATTAAGCATTATTACATC
GGCAAAATCTGGCTCATGGACCTGCTCAAGGAGGAGAACTATCACGAAGATGATATTGAGGCGTTTGCCCAGAGA
ATCGATGAGTGGGACATTCGGAGAATCACTCGTAACTTGACAACCGCCACGACCCAGTTGAAACAAATCCCATTG
GAGAAAATTAGCTTGGATGTCTTGGACAGGGCTGCATTGCTGTCAATCTTCGAGACCCTGAGCTGTGAAGCCATG
CTGCGCAACGAAAGCCTTTTGCAGGAATATTTTGATGAGCCATTCAAACTCATTCAAACAAAGCGAAGCTTGAAA
GTTTCAGATTATATTCCTGCAGTCTCTCGCTTTCTTTTTGATTCTAATCAATTCCGAAGCTTCTGGGCTGTTCAG
TCATGGACAAGATACTCGCGGCCTCCTACTAATCAAGAATTTGATTGGGCAGTACGCGATGGCTTGCTGATGGGC
CTGCGGGCTGCGTCACAGCAGCCACCTCAATTCGCAGTCATTCAGAGGTTGTGGCGAGGTATGCAGCTTGTTGTC
CGAAAGCTGGACAAAGAGCAGATTACACATCAGCTTCGAGGGTTGGAAATAGACCCTTGTCGTCTCTCCGTGGAT
CATCTCGCCATACCTGCGCCGAGCTTGCGATTCCTTCTCAACACCATCCAACTATTCCTCGAGAAAGCCCCGGTT
GATTTCTGGGATGCTATGCAAACCATCTCTCCCCAAGCAATCATGGAACAGGCATTTTACAACACACAATTCAAT
GCTTTTCTCCTGGAAACCTCTGAGGGTGAGCCCTTTGAGAAATCCGCTTTGAAAGACATGCTCTCCTGGATCAAT
CCCTTCCTCGGCTCACTGAAGGGTGCTCACCAGCCGTCTGCCTGTCGGTTCTTGATATTGCAATTACTTGGCCGT
CTTCAAGATACTCAATATCCCAATCTGTCGCGCTATCACTGCTTTGACATTGGTTTGGCCAGTCTCCTTCAAACA
CTACGCCGCTTCACAGAAAATGAGTCTTCCCGGGGTACAGTAACTCGGATCGTATTGGCAGAGACAATGGGAGTG
GTTGGTGATACAATCGACGCAATCATCAGCCCCCCGACCTTTGATGTTGAGCGAAGTCGGCAGAATGGCATTCTC
ACGCAGTGCATGGAAGTTGTACGCAACACTTTGGCATTGGAGTGTCAATCGTTGAAGACCGACTATGAGGCACTT
CTGAAGCACGGTACGCTCTCACATGGAGTATCTACCTACTCTGCACCCATCTGGGATGCTGTGATCAAGCACCTC
CACCGGGATAACCTGCCGCTGTCAAGTTCGGCCCTCTTAGGAATCTTGCCCCTGGTTGGCTTGGAGATGTTTCCC
ACGAAAGGAGAAGGGAACAAGGAGAAGACCCACTTCAATATGATTTATGGCCATCTCACCAACCTCTCATGTCGA
ATCATCGAGCGTCTCGCGGACTTTCCACCCGAGCACCTTGAAACGTTGTTCCAAAGCCAGGATACTAGTAGCGCC
GTTATTTCGGCTCTGTTTGCCGCCGACTATGACACCTATACAGCTGCGGTTGACTTGATCAAGGCCGTCAGTGGC
CAGTCAGCTCGACGAGATGCCATTTCTCACCTCCTCCAATCTTCGTTCACGACCACAATTTACGGACTCAGTTGG
TCATTCCGTCGGATATCTCACATGAAGACTTTTGCACCCGCCCCAAGAATGCTATACACTGGTACAGACATCGTA
GAGATATTATGTGACAGTCAAACCGGTATGCTGCGAACTCGTAATCTCGCTGATCGCCGGGAGGTTGTGTCGCTG
CAGAAGCTTTGGGAGTATCTGTGGCTGGCACTGACCACGATCTTTGATGAGACCGAGGCATGGCATCTTCGGGGG
AATGATAAGGCTGTCATGCTCGAATTTTGCCGTGACACGATTCAGTTCGCTGACCTTCTTTTTGATCAATATGGT
GTGTTCTTGGGAGCTGTAGGGAATGCGGACCCGGGGCAGACTTCTGCATCCGAAAATTTCCTCAAGTCCCCAACA
GCCACAATGAGTGCTATGGTAAAATGGCTTAGGTTGAAGGATGAGTTCTTGGCAACGACGCTCGTAGGGTTGGTG
GCAAAACTTCTACGCAGATTGGGTGGGATGAATGTGACCACTGTGAAGCCAGATGCATTGAGCTTTATTGAGGGG
GTGGCTGTCAATGGCACAATCAAAACAATACTCAACCAACGTGAGAAGGCAGAATTAGTCCGCTCATTGGAGGCT
TACTATAAGAAACCTGTCGTCACTGCCTCAACTGCTGCTCTCAAGAAACAGTCTTCGATCACCGCTTTTGCCAAA
CCCTCTGCTTCCAGCCCCTCCTCTCGCATCACCAGTGACGATGACTTTGATGATGATACTTTGAACGACCAAACT
CTTCTTGAGCTGTCTTCTTCTGTCGAATTCAACAAGGCTCGCCTCGCAACCCAAGCCAAACGCGCAGCTGAAAAG
GCCACCAAAATGCACTCCTCAACGGCTCTCAAGAATCGTCCGGACATTTTCCCTCCGAGGATGTTTCCCAAGTCA
GTTCCTCCTCTACGATCTAACAATGACCCCACCCACGTCCTATCTTTCCGTGAGAAGCGCGAACGGGAAAGGGAG
GCCAAGAAGAAGCGTGATCAGATTGAGCTCGCCAGACTCAAAAAGAACACGACCGCATATGGTGTTGGGGAGCAA
ACAGCTGAACAAGGCTCTGGCCTGAAAGGTATTGGTATCAAGGGTAAAGATCATACAACCCCTGCAGATAGCATG
ATGGTTTCCTCTGGTGACGAGTCTGATTCTGAGAGCGAAGATGAATTAGACAAGGAACTCTTTGGTGCCAAACCG
AAGAAACCCGACGCCGTCGCGGCCTACGAATTGAGCAAAAAACAATCCCTTCAACAGCAACCCATCAAAAAGGTC
AAGCGCCATCGGTCTGTCAGGGACATGCGGGCTCGCCTGGCTCCAGATCTGAGTTCTCTTCACCGTTCAATCCTC
TCCTGGGACTTTTTCGCAACCGGCGATCTTCCTCCTTCCTCGGATCGCACTGATTATTCCCTGGTCTCAAACACG
TTCCGCACACCCGATGCCTACCAGAGTACATTCGAACCTTTGTTAATTCTTGAAGCGTGGCAAGGTTTTCAACAG
GCGAAGGACGAAGGTTCTTTCCGACCCTTCGAAGTCAAAGTCATGACCCGATTGGCTGTCGACTCGTGGATCGAA
TTCAGCACCCAGCCGCTTGGTGTTCTTCCCAAGGATTTTAGCATGGGCGAAGGTGATTTGGTCATGTTCTCCAGC
TCGCCCAAACTCACAAGCGACCCGAGTGCGCCCCATGTTCTCGCTCGTGTATGCGGTGTCAATCGAAAGAACAAA
AAGATGGAGGTCACATATCGGGTCAATCCTGGGAGTAACAAGTTCCTGTCTTCTTTAGGGCCGGGAACCGAGGCA
TGGGGTGCCAAGATCACTTCTTTGATCCCAGTGGAGCGTGAATATGGTGCCCTAATGGCGTTGCAGTACTATGAT
CTGTGTGAAGAGATTGTCTTGGCTAAGCCTTCACCTCTTCTCACTTATTCGGACGCAAGACTGCAACCCATCATG
GATAATTACTCCATCAATCGTGCTCAGGCAAAAGCCATCAAGTCAGCTGTCGACAACGACGCTTTTACTCTCATC
CAAGGTCCTCCTGGTTCGGGAAAAACCAAAACAATCATCGCGCTTGTCGGAAGTCTTCTAAGCGACGTGCTTGGG
AAACAGGTGATCAAAGTCAACGGTGCCCCTGTTGCGAGAAACTCCCTCTCAAAGAAACTTCTCCTTTGCGCGCCT
AGCAATGCCGCCGTCGACGAGTTAGTCATGCGATTGAAGGATGGTGTGAGGACGACTCATGGTCGGCAAGAAAAG
GTCTCTGTTCTTCGTTTAGGAAGAAGTGACGCAATCAACACCAATGTGTTAGATGTTACCCTTGATGAGATGGTC
AATGCCCGTCTGAATCAGGATCCTAGCAAAGGAAATGGTGTCGACTTGCAGAAGCTCTATGAAGAGCATAAGACG
ACTGATACGTCATTCAAAGAGCTTCGTGGCCGCCTCGATGAGGCACGAGCAAAGGGATTACCTCCTCCGGAAGAG
CTGGAGCGCGAATTTCACTTGATGAAAAAGAAACGGTCCCAATTAAGCACGTCTATTGATAAGGCCCGTGACCAG
AACCATACGCTGGCCCGCAATGCTGATATGCATAAACGGCGGATCCAAGAACAAATCATCAACGAAGCTCATGTC
ATTTGCACTACTCTCAGTGGATCTGGACATGAAATTTTCCAGGGTATGAATGTCGAGTTTGAGACCGTCATCATC
GATGAGGCGGCGCAGTGTATTGAACTCAGTGCTCTTATCCCGCTGAAGTACGGCTGCTCGAAGTGTGTTCTTGTC
GGTGATCCCAAACAGTTGCCTCCAACTGTACTGTCAAAAATGGCGTCCAAGTTCCAGTATGAACAGAGCTTGTTC
GTCCGCATGCAGAAGAATCACCCTCGAGACGTGCATTTGCTGGATATCCAGTACCGTATGCACCCAGCCATCAGT
CATTTCCCCAGTGTGACGTTCTATGATGGCAAGTTGCAGGATGGACCGGACATGGCCAAGCTTCGCCAGCGTCCC
TGGCATCAAAGCGAGCTTCTCAGTCCTTACCGATTTTTTGATGTCCAGGGCATGCACTCATCTGCGGCCAGGGGT
CATTCCTTGATCAATTACGCGGAGTTACAAGTGGCCATGCAACTGTATGATCGTTTGATCACAGATGTCAAAGAA
TACGACTTTGCGGGCAAGATTGGCATCATCACACCTTATAAGGGCCAACTAAGAGAGCTCAAGAACCAATTTACC
CAACGATACGGCGAAGACATTTTGAAGAAGGTCGATTTCAATACGACTGACGCTTTCCAAGGTAGAGAAAGTGAA
ATCATTATCTTCTCCTGTGTGCGAGCATCCAACAAGGGTATTGGTTTCTTGGCTGATATCCGCCGTATGAACGTC
GGTCTCACCCGTGCCAAGTCATCGCTCTGGGTTCTGGGTAACTCGCAGTCCCTAGAACAGGGTCAGTTCTGGAGT
CGGCTCATTCAGAACGCGCGGGAGCGAAATGTCTACACGGAGGGTGATATTGTGAAAATCCTGGAGAAGCCGCAA
TTCACTGGCTACAAAGAGATTGAAATGGTCGACCTTGACACAGCAGAAGCTCCAGGCTCTCCCGACTATGAGCCC
CCTGTACCGCCAATTTCCCGACCTTCGTCGGCCTCCGTCTCAGTGTCTGCCTCTGGCCACGGTACATCCCCAATT
CCACAACCCGATGGACCTTCTGGGGGAGCCAAGGGCTTAGACCCGACGAAAATGTGTGGGATCTGTGGAAGCGCC
AACCATTTTACTTACAACTGCGACAATGACGAAGCAAAGGCAAATGCTCGAGGAACCTGTTTCCGCTGCGGTCAG
CCTGGCCACACTAAGATTTCCTGCCGTGCCGAACGATGCGTTGAATGCGGTGAATGTGGGCACTCATCCCGCAAC
TGCACGTCCACGAAAGTTCTTTCAAAGATCGAGAAATCTCGCCTGGAGAGGGACGAATATATCCTCAAGCAACGT
CAAGATTCATCGACCGAGCGTCAGCGAGAACGTCAACTAGGAGGACACAACCCCAAAATTCCTGTTGTTCGAGCC
ACAAATTCAACCGCGCCAATCAACACTCTTGATAATTCTGCGAAGAGAAAACGTGAAGAATCTTCCTCTAATGGA
CCACAAGCGCAACGTCCTCGTACCGGGCAGCCACATCCCCCAATCCATGTTCCAAAGGGTTCATTGGGTAGTAAT
CATCCCGGTCTATCTGGCCCGGCTGCCCGTGGTTCGAATGTCCCAAGAGTCAGTGGTCACCCGGGTCTTTCTGGT
CCCCCTCGCGACAACCTAGTGGCCAATACTCAAAATGGTTACAAGGGCCCGCTAGCCAATGGCTCACCAGGAGGT
CTCATCAAGCCTTCTCGCGATGGCCAGGCGTATCCGACCGAAAATGACCCGACAAGGGCTCCACCAATGCGATCT
GGAGCAGATGTTCCCAACCAAGCTGCTCCCAAGCCCCGACCTCCAATAATGCGCAAAAAGAAGGCGACAGACCCT
TTCATCCGGCCCAAGCCAAAACGCAAGTAA
Gene >Pro_DTO377G3_2|g4345.t1
ATGGAGTTTCTGGCTGCGATTAGGTAGGCCCCAGAAAACCTTCCCAAGCAAACGAGCTGGAACTAACCAGATTGT
GTCTTGTACAGAGAACTCAAGGCCCTCCCGGAGACCACCCACCTCTTCTGTCCCCGGAAAGACAACGATGATCAT
GGACGCTACGAAGATTTAGAGCAAGTGGACGAATCAGGAAAGGCCGTCAAGGATATCGTAGCTGAAGCAACGGCT
CGAAGAGAGAGTTTTCTCTCGTCCATGCGCATCCTGGCATACCATAAGGATGGCGTGGAAGACGATCAGAACTGG
ATCCTGGGAAAACTAGACGAATCTCTGGAGAAATGTGATCTATGCATTAAGCATTATTACATCGGCAAAATCTGG
CTCATGGACCTGCTCAAGGAGGAGAACTATCACGAAGATGATATTGAGGCGTTTGCCCAGAGAATCGATGAGTGG
GACATTCGGAGAATCACTCGTAACTTGACAACCGCCACGACCCAGTTGAAACAAATCCCATTGGAGAAAATTAGC
TTGGATGTCTTGGACAGGGCTGCATTGCTGTCAATCTTCGAGACCCTGAGCTGTGAAGCCATGCTGCGCAACGAA
AGCCTTTTGCAGGAATATTTTGATGAGCCATTCAAACTCATTCAAACAAAGCGAAGCTTGAAAGTTTCAGATTAT
ATTCCTGCAGTCTCTCGCTTTCTTTTTGATTCTAATCAATTCCGAAGCTTCTGGGCTGTTCAGTCATGGACAAGA
TACTCGCGGCCTCCTACTAATCAAGAATTTGATTGGGCAGTACGCGATGGCTTGCTGATGGGCCTGCGGGCTGCG
TCACAGCAGCCACCTCAATTCGCAGTCATTCAGAGGTTGTGGCGAGGTATGCAGCTTGTTGTCCGAAAGCTGGAC
AAAGAGCAGATTACACATCAGCTTCGAGGGTTGGAAATAGACCCTTGTCGTCTCTCCGTGGATCATCTCGCCATA
CCTGCGCCGAGCTTGCGATTCCTTCTCAACACCATCCAACTATTCCTCGAGAAAGCCCCGGTTGATTTCTGGGAT
GCTATGCAAACCATCTCTCCCCAAGCAATCATGGAACAGGCATTTTACAACACACAATTCAATGCTTTTCTCCTG
GAAACCTCTGAGGGTGAGCCCTTTGAGAAATCCGCTTTGAAAGACATGCTCTCCTGGATCAATCCCTTCCTCGGC
TCACTGAAGGGTGCTCACCAGCCGTCTGCCTGTCGGTTCTTGATATTGCAATTACTTGGCCGTCTTCAAGATACT
CAATATCCCAATCTGTCGCGCTATCACTGCTTTGACATTGGTTTGGCCAGTCTCCTTCAAACACTACGCCGCTTC
ACAGAAAATGAGTCTTCCCGGGGTACAGTAACTCGGATCGTATTGGCAGAGACAATGGGAGTGGTTGGTGATACA
ATCGACGCAATCATCAGCCCCCCGACCTTTGATGTTGAGCGAAGTCGGCAGAATGGCATTCTCACGCAGTGCATG
GAAGTTGTACGCAACACTTTGGCATTGGAGTGTCAATCGTTGAAGACCGACTATGAGGCACTTCTGAAGCACGGT
ACGCTCTCACATGGAGTATCTACCTACTCTGCACCCATCTGGGATGCTGTGATCAAGCACCTCCACCGGGATAAC
CTGCCGCTGTCAAGTTCGGCCCTCTTAGGAATCTTGCCCCTGGTTGGCTTGGAGATGTTTCCCACGAAAGGAGAA
GGGAACAAGGAGAAGACCCACTTCAATATGATTTATGGCCATCTCACCAACCTCTCATGTCGAATCATCGAGCGT
CTCGCGGACTTTCCACCCGAGCACCTTGAAACGTTGTTCCAAAGCCAGGATACTAGTAGCGCCGTTATTTCGGCT
CTGTTTGCCGCCGACTATGACACCTATACAGCTGCGGTTGACTTGATCAAGGCCGTCAGTGGCCAGTCAGCTCGA
CGAGATGCCATTTCTCACCTCCTCCAATCTTCGTTCACGACCACAATTTACGGACTCAGTTGGTCATTCCGTCGG
ATATCTCACATGAAGACTTTTGCACCCGCCCCAAGAATGCTATACACTGGTACAGACATCGTAGAGATATTATGT
GACAGTCAAACCGGTATGCTGCGAACTCGTAATCTCGCTGATCGCCGGGAGGTTGTGTCGCTGCAGAAGCTTTGG
GAGTATCTGTGGCTGGCACTGACCACGATCTTTGATGAGACCGAGGCATGGCATCTTCGGGGGAATGATAAGGCT
GTCATGCTCGAATTTTGCCGTGACACGATTCAGTTCGCTGACCTTCTTTTTGATCAATATGGTGTGTTCTTGGGA
GCTGTAGGGAATGCGGACCCGGGGCAGACTTCTGCATCCGAAAATTTCCTCAAGTCCCCAACAGCCACAATGAGT
GCTATGGTAAAATGGCTTAGGTTGAAGGATGAGTTCTTGGCAACGACGCTCGTAGGGTTGGTGGCAAAACTTCTA
CGCAGATTGGGTGGGATGAATGTGACCACTGTGAAGCCAGATGCATTGAGCTTTATTGAGGGGGTGGCTGTCAAT
GGCACAATCAAAACAATACTCAACCAACGTGAGAAGGCAGAATTAGTCCGCTCATTGGAGGCTTACTATAAGAAA
CCTGTCGTCACTGCCTCAACTGCTGCTCTCAAGAAACAGTCTTCGATCACCGCTTTTGCCAAACCCTCTGCTTCC
AGCCCCTCCTCTCGCATCACCAGTGACGATGACTTTGATGATGATACTTTGAACGACCAAACTCTTCTTGAGCTG
TCTTCTTCTGTCGAATTCAACAAGGCTCGCCTCGCAACCCAAGCCAAACGCGCAGCTGAAAAGGCCACCAAAATG
CACTCCTCAACGGCTCTCAAGAATCGTCCGGACATTTTCCCTCCGAGGATGTTTCCCAAGTCAGTTCCTCCTCTA
CGATCTAACAATGACCCCACCCACGTCCTATCTTTCCGTGAGAAGCGCGAACGGGAAAGGGAGGCCAAGAAGAAG
CGTGATCAGATTGAGCTCGCCAGACTCAAAAAGAACACGACCGCATATGGTGTTGGGGAGCAAACAGCTGAACAA
GGCTCTGGCCTGAAAGGTATTGGTATCAAGGGTAAAGATCATACAACCCCTGCAGATAGCATGATGGTTTCCTCT
GGTGACGAGTCTGATTCTGAGAGCGAAGATGAATTAGACAAGGAACTCTTTGGTGCCAAACCGAAGAAACCCGAC
GCCGTCGCGGCCTACGAATTGAGCAAAAAACAATCCCTTCAACAGCAACCCATCAAAAAGGTCAAGCGCCATCGG
TCTGTCAGGGACATGCGGGCTCGCCTGGCTCCAGATCTGAGTTCTCTTCACCGTTCAATCCTCTCCTGGGACTTT
TTCGCAACCGGCGATCTTCCTCCTTCCTCGGATCGCACTGATTATTCCCTGGTCTCAAACACGTTCCGCACACCC
GATGCCTACCAGAGTACATTCGAACCTTTGTTAATTCTTGAAGCGTGGCAAGGTTTTCAACAGGCGAAGGACGAA
GGTTCTTTCCGACCCTTCGAAGTCAAAGTCATGACCCGATTGGCTGTCGACTCGTGGATCGAATTCAGCACCCAG
CCGCTTGGTGTTCTTCCCAAGGATTTTAGCATGGGCGAAGGTGATTTGGTCATGTTCTCCAGCTCGCCCAAACTC
ACAAGCGACCCGAGTGCGCCCCATGTTCTCGCTCGTGTATGCGGTGTCAATCGAAAGAACAAAAAGATGGAGGTC
ACATATCGGGTCAATCCTGGGAGTAACAAGTTCCTGTCTTCTTTAGGGCCGGGAACCGAGGCATGGGGTGCCAAG
ATCACTTCTTTGATCCCAGTGGAGCGTGAATATGGTGCCCTAATGGCGTTGCAGTACTATGATCTGTGTGAAGAG
ATTGTCTTGGCTAAGCCTTCACCTCTTCTCACTTATTCGGACGCAAGACTGCAACCCATCATGGATAATTACTCC
ATCAATCGTGCTCAGGCAAAAGCCATCAAGTCAGCTGTCGACAACGACGCTTTTACTCTCATCCAAGGTCCTCCT
GGTTCGGGAAAAACCAAAACAATCATCGCGCTTGTCGGAAGTCTTCTAAGCGACGTGCTTGGGAAACAGGTGATC
AAAGTCAACGGTGCCCCTGTTGCGAGAAACTCCCTCTCAAAGAAACTTCTCCTTTGCGCGCCTAGCAATGCCGCC
GTCGACGAGTTAGTCATGCGATTGAAGGATGGTGTGAGGACGACTCATGGTCGGCAAGAAAAGGTCTCTGTTCTT
CGTTTAGGAAGAAGTGACGCAATCAACACCAATGTGTTAGATGTTACCCTTGATGAGATGGTCAATGCCCGTCTG
AATCAGGATCCTAGCAAAGGAAATGGTGTCGACTTGCAGAAGCTCTATGAAGAGCATAAGACGACTGATACGTCA
TTCAAAGAGCTTCGTGGCCGCCTCGATGAGGCACGAGCAAAGGGATTACCTCCTCCGGAAGAGCTGGAGCGCGAA
TTTCACTTGATGAAAAAGAAACGGTCCCAATTAAGCACGTCTATTGATAAGGCCCGTGACCAGAACCATACGCTG
GCCCGCAATGCTGATATGCATAAACGGCGGATCCAAGAACAAATCATCAACGAAGCTCATGTCATTTGCACTACT
CTCAGTGGATCTGGACATGAAATTTTCCAGGGTATGAATGTCGAGTTTGAGACCGTCATCATCGATGAGGCGGCG
CAGTGTATTGAACTCAGTGCTCTTATCCCGCTGAAGTACGGCTGCTCGAAGTGTGTTCTTGTCGGTGATCCCAAA
CAGTTGCCTCCAACTGTACTGTCAAAAATGGCGTCCAAGTTCCAGTATGAACAGAGCTTGTTCGTCCGCATGCAG
AAGAATCACCCTCGAGACGTGCATTTGCTGGATATCCAGTACCGTATGCACCCAGCCATCAGTCATTTCCCCAGT
GTGACGTTCTATGATGGCAAGTTGCAGGATGGACCGGACATGGCCAAGCTTCGCCAGCGTCCCTGGCATCAAAGC
GAGCTTCTCAGTCCTTACCGATTTTTTGATGTCCAGGGCATGCACTCATCTGCGGCCAGGGGTCATTCCTTGATC
AATTACGCGGAGTTACAAGTGGCCATGCAACTGTATGATCGTTTGATCACAGATGTCAAAGAATACGACTTTGCG
GGCAAGATTGGCATCATCACACCTTATAAGGGCCAACTAAGAGAGCTCAAGAACCAATTTACCCAACGATACGGC
GAAGACATTTTGAAGAAGGTCGATTTCAATACGACTGACGCTTTCCAAGGTAGAGAAAGTGAAATCATTATCTTC
TCCTGTGTGCGAGCATCCAACAAGGGTATTGGTTTCTTGGCTGATATCCGCCGTATGAACGTCGGTCTCACCCGT
GCCAAGTCATCGCTCTGGGTTCTGGGTAACTCGCAGTCCCTAGAACAGGGTCAGTTCTGGAGTCGGCTCATTCAG
AACGCGCGGGAGCGAAATGTCTACACGGAGGGTGATATTGTGAAAATCCTGGAGAAGCCGCAATTCACTGGCTAC
AAAGAGATTGAAATGGTCGACCTTGACACAGCAGAAGCTCCAGGCTCTCCCGACTATGAGCCCCCTGTACCGCCA
ATTTCCCGACCTTCGTCGGCCTCCGTCTCAGTGTCTGCCTCTGGCCACGGTACATCCCCAATTCCACAACCCGAT
GGACCTTCTGGGGGAGCCAAGGGCTTAGACCCGACGAAAATGTGTGGGATCTGTGGAAGCGCCAACCATTTTACT
TACAACTGCGACAATGACGAAGCAAAGGCAAATGCTCGAGGAACCTGTTTCCGCTGCGGTCAGCCTGGCCACACT
AAGATTTCCTGCCGTGCCGAACGATGCGTTGAATGCGGTGAATGTGGGCACTCATCCCGCAACTGCACGTCCACG
AAAGTTCTTTCAAAGATCGAGAAATCTCGCCTGGAGAGGGACGAATATATCCTCAAGCAACGTCAAGATTCATCG
ACCGAGCGTCAGCGAGAACGTCAACTAGGAGGACACAACCCCAAAATTCCTGTTGTTCGAGCCACAAATTCAACC
GCGCCAATCAACACTCTTGATAATTCTGCGAAGAGAAAACGTGAAGAATCTTCCTCTAATGGACCACAAGCGCAA
CGTCCTCGTACCGGGCAGCCACATCCCCCAATCCATGTTCCAAAGGGTTCATTGGGTAGTAATCATCCCGGTCTA
TCTGGCCCGGCTGCCCGTGGTTCGAATGTCCCAAGAGTCAGTGGTCACCCGGGTCTTTCTGGTCCCCCTCGCGAC
AACCTAGTGGCCAATACTCAAAATGGTTACAAGGGCCCGCTAGCCAATGGCTCACCAGGAGTAAGTTTTTCTCGC
TATTTCAACAACTAGCTTTCATACATGCTGACAACTCCTTAGGGTCTCATCAAGCCTTCTCGCGATGGCCAGGCG
TATCCGACCGAAAATGACCCGACAAGGGCTCCACCAATGCGATCTGGAGCAGATGTAAGCGTCATGTTCTTGTCT
GACTTTGTTATTGATTACTGACACCGATTTCTTATCAATATAGGTTCCCAACCAAGCTGCTCCCAAGCCCCGACC
TCCAATAATGCGCAAAAAGAAGGCGACAGACCCTTTCATCCGGCCCAAGCCAAAACGCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail