Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4338.t1
Gene name
Locationscaffold_08:735191..736212
Strand+
Gene length (bp)1021
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13405 EF-hand_6 EF-hand domain 1.3E-06 130 159
PF13499 EF-hand_7 EF-hand domain pair 1.1E-07 130 224

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 34.72 17.55 51.89
5d_25C Five days - 25 degrees Celsius 19.04 7.74 30.33
7d_25C Seven days - 25 degrees Celsius 22.65 9.39 35.91
10d_25C Ten days - 25 degrees Celsius 10.73 3.18 18.28
7d_15C Seven days - 15 degrees Celsius 20.50 7.13 33.86
7d_30C Seven days - 30 degrees Celsius 20.65 8.85 32.45

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.049004 yes
3d_25C 7d_25C 0.163473 no
3d_25C 7d_15C 0.108929 no
3d_25C 7d_30C 0.082459 no
3d_25C 10d_25C 0.001278 yes
5d_25C 7d_25C 0.682570 no
5d_25C 7d_15C 0.887394 no
5d_25C 7d_30C 0.864545 no
5d_25C 10d_25C 0.121015 no
7d_25C 7d_15C 0.836512 no
7d_25C 7d_30C 0.838748 no
7d_25C 10d_25C 0.029770 yes
7d_15C 7d_30C 0.989327 no
7d_15C 10d_25C 0.081872 no
7d_30C 10d_25C 0.065980 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4338.t1
MANNPTFKPSPLSFGSPRASPFRRPSTPNSPPSASRTGGTPGSSPSRAYTPMVSPSKLNQSYTVEDGESRSPKNE
RPIPQPNFAREFSPSPTKGGKSPGSLSPIHGSRTGGVASPAGDAAGKLPAQQVREIREAFQVLDRDNDGLVDKDD
VIDVLTTLGQDSSSSTLSRFFPPGAGNTMNFPTFLNTLSGLMASMSPSQELLNALAAFDDDDSGQIDATELRDAL
LHTSPEDGEERLTERQIDEVFSGFIGRPAFIGRGAKSGGMGKRGEVFQYHDFVRSIMGGDNGNSAKNEGDAHV*
Coding >Pro_DTO377G3_2|g4338.t1
ATGGCCAACAATCCCACATTCAAACCATCGCCGTTATCCTTTGGGTCGCCGAGGGCATCCCCGTTCCGGCGCCCA
TCCACTCCAAATTCCCCGCCTTCGGCCAGTCGCACAGGAGGCACCCCGGGGAGCTCTCCCAGTCGGGCATATACA
CCTATGGTATCTCCTAGCAAGCTCAATCAATCATATACAGTGGAGGATGGTGAATCGCGTTCTCCGAAGAACGAG
CGGCCCATTCCCCAGCCGAATTTTGCCAGAGAGTTCTCTCCTTCCCCAACGAAAGGAGGAAAGTCGCCAGGCAGC
TTATCCCCAATCCATGGGTCAAGGACGGGTGGAGTTGCAAGCCCAGCTGGCGACGCGGCTGGGAAGCTGCCAGCG
CAACAAGTGAGGGAGATCAGAGAAGCTTTCCAGGTTCTCGATAGGGATAACGACGGGCTTGTGGACAAAGATGAT
GTGATTGATGTGCTGACAACTTTGGGCCAAGACTCGTCATCCTCTACGCTCTCGCGCTTCTTTCCACCAGGAGCA
GGCAATACTATGAATTTTCCAACCTTCTTGAATACCCTTTCTGGGCTCATGGCATCGATGTCACCTTCACAAGAG
CTTCTCAACGCTCTTGCTGCGTTTGATGATGATGACAGCGGGCAAATCGATGCCACGGAATTACGTGATGCTCTC
CTACATACCTCCCCAGAAGATGGAGAGGAAAGATTGACTGAGAGACAGATCGATGAAGTCTTCAGTGGGTTTATA
GGGCGCCCAGCATTTATTGGTCGGGGAGCGAAGTCAGGCGGGATGGGTAAGAGGGGTGAGGTTTTCCAGTATCAC
GACTTCGTGCGCAGCATCATGGGTGGGGATAATGGAAATAGTGCCAAGAATGAAGGAGATGCACATGTATGA
Transcript >Pro_DTO377G3_2|g4338.t1
ATGGCCAACAATCCCACATTCAAACCATCGCCGTTATCCTTTGGGTCGCCGAGGGCATCCCCGTTCCGGCGCCCA
TCCACTCCAAATTCCCCGCCTTCGGCCAGTCGCACAGGAGGCACCCCGGGGAGCTCTCCCAGTCGGGCATATACA
CCTATGGTATCTCCTAGCAAGCTCAATCAATCATATACAGTGGAGGATGGTGAATCGCGTTCTCCGAAGAACGAG
CGGCCCATTCCCCAGCCGAATTTTGCCAGAGAGTTCTCTCCTTCCCCAACGAAAGGAGGAAAGTCGCCAGGCAGC
TTATCCCCAATCCATGGGTCAAGGACGGGTGGAGTTGCAAGCCCAGCTGGCGACGCGGCTGGGAAGCTGCCAGCG
CAACAAGTGAGGGAGATCAGAGAAGCTTTCCAGGTTCTCGATAGGGATAACGACGGGCTTGTGGACAAAGATGAT
GTGATTGATGTGCTGACAACTTTGGGCCAAGACTCGTCATCCTCTACGCTCTCGCGCTTCTTTCCACCAGGAGCA
GGCAATACTATGAATTTTCCAACCTTCTTGAATACCCTTTCTGGGCTCATGGCATCGATGTCACCTTCACAAGAG
CTTCTCAACGCTCTTGCTGCGTTTGATGATGATGACAGCGGGCAAATCGATGCCACGGAATTACGTGATGCTCTC
CTACATACCTCCCCAGAAGATGGAGAGGAAAGATTGACTGAGAGACAGATCGATGAAGTCTTCAGTGGGTTTATA
GGGCGCCCAGCATTTATTGGTCGGGGAGCGAAGTCAGGCGGGATGGGTAAGAGGGGTGAGGTTTTCCAGTATCAC
GACTTCGTGCGCAGCATCATGGGTGGGGATAATGGAAATAGTGCCAAGAATGAAGGAGATGCACATGTATGA
Gene >Pro_DTO377G3_2|g4338.t1
ATGGTAACTAAGGATCCTGAGGGATGATATAACTATTAAAAACTAATCAACAATGACCCAGGCCAACAATCCCAC
ATTCAAACCATCGCCGTTATCCTTTGGGTCGCCGAGGGCATCCCCGTTCCGGCGCCCATCCACTCCAAATTCCCC
GCCTTCGGCCAGTCGCACAGGAGGCACCCCGGGGAGCTCTCCCAGTCGGGCATATACACCTATGGTATCTCCTAG
CAAGCTCAATCAATCATATACAGTGGAGGATGGTGAATCGCGTTCTCCGAAGAACGAGCGGCCCATTCCCCAGCC
GAATTTTGCCAGAGAGTTCTCTCCTTCCCCAACGAAAGGAGGAAAGTCGCCAGGCAGCTTATCCCCAATCCATGG
GTCAAGGACGGGTGGAGTTGCAAGCCCAGCTGGCGACGCGGCTGGGAAGCTGCCAGCGCAACAAGTGAGGGAGAT
CAGAGAAGCTTTCCAGGTTCTCGATAGGGATAACGACGGGCTTGTGGACAAAGATGATGTGATTGATGTGCTGAC
AACTTTGGGTAGGAGAAAATCTACCTATATTTTTTGGAAATTCGGACGAGGGACTAATCCGAGTATCTGAACAGG
CCAAGACTCGTCATCCTCTACGCTCTCGCGCTTCTTTCCACCAGGAGCAGGCAATACTATGAATTTTCCAACCTT
CTTGAATACCCTTTCTGGGCTCATGGCATCGATGTCACCTTCACAAGAGCTTCTCAACGCTCTTGCTGCGTTTGA
TGATGATGACAGCGGGCAAATCGATGCCACGGAATTACGTGATGCTCTCCTACATACCTCCCCAGAAGATGGAGA
GGAAAGATTGACTGAGAGACAGATCGATGAAGTCTTCAGTGGGTTTATAGGGCGCCCAGCATTTATTGGTCGGGG
AGCGAAGTCAGGCGGGATGGGTAAGAGGGGTGAGGTTTTCCAGTATCACGACTTCGTGCGCAGCATCATGGGTGG
GGATAATGGAAATAGTGCCAAGAATGAAGGAGATGCACATGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail