Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4319.t1
Gene name
Locationscaffold_08:673685..676323
Strand+
Gene length (bp)2638
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04811 Sec23_trunk Sec23/Sec24 trunk domain 5.0E-80 127 392
PF08033 Sec23_BS Sec23/Sec24 beta-sandwich domain 1.6E-29 403 507
PF04815 Sec23_helical Sec23/Sec24 helical domain 4.3E-24 521 619
PF04810 zf-Sec23_Sec24 Sec23/Sec24 zinc finger 1.8E-15 60 99
PF00626 Gelsolin Gelsolin repeat 7.0E-12 635 722

GO

GO Term Description Terminal node
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0008270 zinc ion binding Yes
GO:0030127 COPII vesicle coat Yes
GO:0006886 intracellular protein transport Yes
GO:0008104 protein localization No
GO:0044464 cell part No
GO:0048193 Golgi vesicle transport No
GO:0046872 metal ion binding No
GO:0045184 establishment of protein localization No
GO:0044446 intracellular organelle part No
GO:0051649 establishment of localization in cell No
GO:0044444 cytoplasmic part No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0030120 vesicle coat No
GO:0051179 localization No
GO:0051641 cellular localization No
GO:0071702 organic substance transport No
GO:0042886 amide transport No
GO:0016192 vesicle-mediated transport No
GO:0098796 membrane protein complex No
GO:0003674 molecular_function No
GO:0044433 cytoplasmic vesicle part No
GO:0044425 membrane part No
GO:0044424 intracellular part No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0015031 protein transport No
GO:0044422 organelle part No
GO:0043167 ion binding No
GO:0071705 nitrogen compound transport No
GO:0008150 biological_process No
GO:0030117 membrane coat No
GO:0032991 protein-containing complex No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0033036 macromolecule localization No
GO:0015833 peptide transport No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4319.t1
MDYEALKDQWSDVEDRDGLRLSWNTFPSTRMEASRLVVPIAAVYTPLKEKPDAPLLQYEPVTCKQPCRAVLNPYA
TVDVRARVWICPFCLSRNPLPPHYKDITENTIPPELHPQSTTIEYQLARPAPAPPIFVFVVDTCQEDDSLQAVKD
SLIMSLSLLPPNALVGLITFGTMAQVHELGYIECAKSYVFRGNKEYNAKQVQEMLGLSGGVRPGVPQQQPARPPL
GPAARFLMPVQQAEFQITNVLEQLQRDPWPVANDKRPLRCTGVALSVAVGLLESSFQNAGGRIMTFTSGAATEGP
GHVVSPELKEPIRSHHDIERDNIKYYKKAVKFYDALAKRAANNGHIVDIFAGCLDQVGLLEMKNLSNFTGGYMLL
TDSFTSSQFKQSFVRVFDKDAADNLLMGFNASLEVLTTKELKVTGLIGHAISLNKKSSSVGETECGIGNTCAWKM
CGMDPSSSYGIYFEIANQGGPAAVQPGPQRGMIQFLTYYQHSSGHYHLRVTTTARPLSGPAGDPTLAQSFDQEAA
AVLMARIAVFKAEVDDGPDVLRWVDRMLIRLCSRFADYRKDDPTSFRLEKNFTLYPQFMFHLRRSQFLQVFNNSP
DETAFYRHVLNHEDTGDSLVMIQPTLDSYSLEQEGAQPVLLDSASIQPAHILLLDTFFHILIFNGETIAEWRKAG
YHEQEGYENLKLLLEQPKEDARDLISDRFPLPRFIVCDAGGSQARFLLSKLNPSTTHTTGGYGGGVSSQTIFTDD
VSLQTFMDHLMKLAVSGTS*
Coding >Pro_DTO377G3_2|g4319.t1
ATGGATTACGAAGCGCTCAAGGATCAATGGAGCGATGTGGAGGACCGCGATGGCCTCAGGCTCAGTTGGAACACT
TTCCCGAGCACTCGTATGGAAGCGTCCCGCTTGGTCGTTCCCATCGCCGCCGTGTACACACCGTTGAAGGAAAAG
CCCGACGCTCCCTTGCTACAATATGAGCCCGTTACTTGCAAGCAGCCCTGCCGAGCTGTGCTCAACCCATATGCC
ACTGTCGATGTCCGCGCACGAGTCTGGATCTGCCCCTTCTGTCTCTCGCGCAACCCTCTCCCTCCGCATTACAAG
GATATTACAGAGAACACGATACCCCCAGAGCTCCACCCCCAGAGCACGACAATCGAGTACCAATTGGCACGGCCA
GCCCCCGCTCCCCCCATTTTCGTCTTTGTCGTCGATACCTGCCAGGAGGATGATAGTCTGCAGGCTGTGAAGGAT
TCCCTCATCATGAGCTTGTCTCTTCTGCCGCCCAATGCGCTGGTTGGTCTGATTACGTTCGGTACAATGGCCCAA
GTTCACGAGCTCGGCTACATCGAATGCGCCAAGTCATACGTGTTCAGAGGCAACAAGGAATACAACGCCAAGCAG
GTTCAGGAGATGCTGGGCCTATCCGGTGGCGTGCGCCCCGGTGTTCCCCAACAACAGCCAGCTCGTCCTCCTCTT
GGCCCGGCTGCGCGCTTCCTCATGCCCGTTCAACAGGCTGAGTTCCAGATCACCAATGTCCTCGAACAATTGCAG
CGCGATCCCTGGCCAGTGGCCAATGACAAGCGTCCCCTGCGCTGCACCGGTGTTGCCCTGAGCGTTGCCGTCGGT
CTGCTTGAGAGTTCCTTCCAGAACGCCGGAGGCCGCATCATGACCTTTACCAGTGGTGCAGCAACTGAGGGCCCT
GGCCACGTTGTTTCGCCTGAACTGAAGGAGCCTATTCGTTCGCACCACGATATTGAACGGGACAATATCAAATAC
TACAAGAAGGCTGTTAAGTTCTATGATGCCCTCGCTAAGCGCGCTGCCAACAATGGCCATATTGTCGATATTTTC
GCCGGCTGTCTTGATCAAGTCGGTTTGCTGGAAATGAAGAACCTCTCCAACTTTACTGGCGGTTACATGCTTCTC
ACCGATAGCTTCACATCCTCACAGTTCAAGCAATCGTTCGTGCGCGTGTTCGACAAGGACGCCGCCGATAACCTC
TTGATGGGCTTCAATGCATCCCTCGAGGTGCTCACGACCAAGGAACTTAAGGTTACTGGTCTGATTGGGCATGCC
ATCTCGCTGAACAAGAAGTCAAGCTCTGTTGGCGAGACAGAATGCGGTATCGGTAACACCTGTGCATGGAAGATG
TGTGGAATGGACCCATCCTCTAGCTACGGTATTTACTTTGAGATTGCCAACCAGGGCGGCCCAGCTGCTGTTCAG
CCTGGTCCTCAACGGGGTATGATTCAGTTTTTGACATACTACCAGCATTCCTCTGGGCATTATCACCTGCGAGTG
ACCACCACTGCCCGCCCCTTGAGCGGACCTGCAGGTGACCCAACCCTGGCACAATCCTTCGACCAAGAGGCTGCC
GCTGTCCTCATGGCCCGTATTGCAGTGTTCAAGGCGGAGGTTGATGACGGTCCAGACGTCCTGCGCTGGGTTGAT
CGTATGCTGATCAGACTCTGCTCCCGATTCGCTGACTACCGGAAAGATGACCCGACATCATTCCGATTGGAAAAG
AACTTCACCTTGTACCCTCAGTTCATGTTCCATCTCCGCCGAAGTCAGTTCTTGCAGGTTTTCAACAACTCGCCC
GATGAGACTGCTTTCTACCGCCACGTTTTGAACCACGAGGATACTGGTGACTCTCTTGTCATGATCCAGCCCACT
CTTGATTCGTACTCTCTGGAGCAAGAGGGTGCTCAGCCAGTGCTGCTGGACTCCGCTTCTATCCAGCCCGCCCAC
ATTCTCCTCCTTGATACCTTCTTCCACATCCTGATCTTCAACGGCGAGACGATTGCCGAATGGAGGAAAGCCGGA
TACCATGAACAAGAGGGATACGAGAATCTCAAGTTGCTTCTTGAGCAGCCTAAAGAGGATGCTAGGGATCTTATT
TCCGACCGTTTCCCCCTGCCGCGTTTCATCGTCTGCGATGCCGGTGGTTCCCAGGCGCGTTTCTTGCTGTCCAAG
TTGAACCCGTCGACCACCCATACCACAGGTGGCTACGGTGGCGGTGTCTCATCGCAGACCATCTTCACTGATGAC
GTATCGCTCCAGACATTCATGGACCACCTGATGAAACTTGCTGTATCTGGAACCAGCTAG
Transcript >Pro_DTO377G3_2|g4319.t1
ATGGATTACGAAGCGCTCAAGGATCAATGGAGCGATGTGGAGGACCGCGATGGCCTCAGGCTCAGTTGGAACACT
TTCCCGAGCACTCGTATGGAAGCGTCCCGCTTGGTCGTTCCCATCGCCGCCGTGTACACACCGTTGAAGGAAAAG
CCCGACGCTCCCTTGCTACAATATGAGCCCGTTACTTGCAAGCAGCCCTGCCGAGCTGTGCTCAACCCATATGCC
ACTGTCGATGTCCGCGCACGAGTCTGGATCTGCCCCTTCTGTCTCTCGCGCAACCCTCTCCCTCCGCATTACAAG
GATATTACAGAGAACACGATACCCCCAGAGCTCCACCCCCAGAGCACGACAATCGAGTACCAATTGGCACGGCCA
GCCCCCGCTCCCCCCATTTTCGTCTTTGTCGTCGATACCTGCCAGGAGGATGATAGTCTGCAGGCTGTGAAGGAT
TCCCTCATCATGAGCTTGTCTCTTCTGCCGCCCAATGCGCTGGTTGGTCTGATTACGTTCGGTACAATGGCCCAA
GTTCACGAGCTCGGCTACATCGAATGCGCCAAGTCATACGTGTTCAGAGGCAACAAGGAATACAACGCCAAGCAG
GTTCAGGAGATGCTGGGCCTATCCGGTGGCGTGCGCCCCGGTGTTCCCCAACAACAGCCAGCTCGTCCTCCTCTT
GGCCCGGCTGCGCGCTTCCTCATGCCCGTTCAACAGGCTGAGTTCCAGATCACCAATGTCCTCGAACAATTGCAG
CGCGATCCCTGGCCAGTGGCCAATGACAAGCGTCCCCTGCGCTGCACCGGTGTTGCCCTGAGCGTTGCCGTCGGT
CTGCTTGAGAGTTCCTTCCAGAACGCCGGAGGCCGCATCATGACCTTTACCAGTGGTGCAGCAACTGAGGGCCCT
GGCCACGTTGTTTCGCCTGAACTGAAGGAGCCTATTCGTTCGCACCACGATATTGAACGGGACAATATCAAATAC
TACAAGAAGGCTGTTAAGTTCTATGATGCCCTCGCTAAGCGCGCTGCCAACAATGGCCATATTGTCGATATTTTC
GCCGGCTGTCTTGATCAAGTCGGTTTGCTGGAAATGAAGAACCTCTCCAACTTTACTGGCGGTTACATGCTTCTC
ACCGATAGCTTCACATCCTCACAGTTCAAGCAATCGTTCGTGCGCGTGTTCGACAAGGACGCCGCCGATAACCTC
TTGATGGGCTTCAATGCATCCCTCGAGGTGCTCACGACCAAGGAACTTAAGGTTACTGGTCTGATTGGGCATGCC
ATCTCGCTGAACAAGAAGTCAAGCTCTGTTGGCGAGACAGAATGCGGTATCGGTAACACCTGTGCATGGAAGATG
TGTGGAATGGACCCATCCTCTAGCTACGGTATTTACTTTGAGATTGCCAACCAGGGCGGCCCAGCTGCTGTTCAG
CCTGGTCCTCAACGGGGTATGATTCAGTTTTTGACATACTACCAGCATTCCTCTGGGCATTATCACCTGCGAGTG
ACCACCACTGCCCGCCCCTTGAGCGGACCTGCAGGTGACCCAACCCTGGCACAATCCTTCGACCAAGAGGCTGCC
GCTGTCCTCATGGCCCGTATTGCAGTGTTCAAGGCGGAGGTTGATGACGGTCCAGACGTCCTGCGCTGGGTTGAT
CGTATGCTGATCAGACTCTGCTCCCGATTCGCTGACTACCGGAAAGATGACCCGACATCATTCCGATTGGAAAAG
AACTTCACCTTGTACCCTCAGTTCATGTTCCATCTCCGCCGAAGTCAGTTCTTGCAGGTTTTCAACAACTCGCCC
GATGAGACTGCTTTCTACCGCCACGTTTTGAACCACGAGGATACTGGTGACTCTCTTGTCATGATCCAGCCCACT
CTTGATTCGTACTCTCTGGAGCAAGAGGGTGCTCAGCCAGTGCTGCTGGACTCCGCTTCTATCCAGCCCGCCCAC
ATTCTCCTCCTTGATACCTTCTTCCACATCCTGATCTTCAACGGCGAGACGATTGCCGAATGGAGGAAAGCCGGA
TACCATGAACAAGAGGGATACGAGAATCTCAAGTTGCTTCTTGAGCAGCCTAAAGAGGATGCTAGGGATCTTATT
TCCGACCGTTTCCCCCTGCCGCGTTTCATCGTCTGCGATGCCGGTGGTTCCCAGGCGCGTTTCTTGCTGTCCAAG
TTGAACCCGTCGACCACCCATACCACAGGTGGCTACGGTGGCGGTGTCTCATCGCAGACCATCTTCACTGATGAC
GTATCGCTCCAGACATTCATGGACCACCTGATGAAACTTGCTGTATCTGGAACCAGCTAG
Gene >Pro_DTO377G3_2|g4319.t1
ATGGATTACGAAGCGCTCAAGGATCAATGGAGCGATGTGGAGGACCGCGATGGCCTCAGGCTCAGTTGGAACACT
TTCCCGAGCACTCGTATGGTTCGTGATAGTGGCCCTCTCTGACCTTCACCGCATCATCCGCTGATGCTTGATATA
GGAAGCGTCCCGCTTGGTCGTTCCCATCGCCGCCGTGTACACACCGTTGAAGGAAAAGCCCGACGCTCCCTTGCT
ACAATATGAGCCCGTTACTTGCAAGCAGCCCTGCCGAGCTGTGCTCAACCCATATGCGTACGTGACATGTCGATC
TGATATACCTCAATGAGTAGATGGACTGACGCTTGGACAGCACTGTCGATGTCCGCGCACGAGTCTGGATCTGCC
CCTTCTGTCTCTCGCGCAACCCTCTCCCTCCGCATTACAAGGATATTACAGAGAACACGATACCCCCAGAGCTCC
ACCCCCAGAGCACGACAATCGAGTACCAATTGGCACGGCCAGCCCCCGCTCCCCCCATTTTCGTCTTTGTCGTCG
ATACCTGCCAGGAGGATGATAGTCTGCAGGCTGTGAAGGATTCCCTCATCATGAGCTTGTCTCTTCTGCCGCCCA
ATGCGCTGGTTGGTCTGATTACGTTCGGTACAATGGTAGGCAATGATGATCTTCGCAACGCAGGTGACATGTTGT
TGACCTTGATATATAGGCCCAAGTTCACGAGCTCGGCTACATCGAATGCGCCAAGTCATACGTGTTCAGAGGCAA
CAAGGAATACAACGCCAAGCAGGTTCAGGAGATGCTGGGCCTATCCGGTGGCGTGCGCCCCGGTGTTCCCCAACA
ACAGCCAGCTCGTCCTCCTCTTGGCCCGGCTGCGCGCTTCCTCATGCCCGTTCAACAGGCTGAGTTCCAGATCAC
CAATGTCCTCGAACAATTGCAGCGCGATCCCTGGCCAGTGGCCAATGACAAGCGTCCCCTGCGCTGCACCGGTGT
TGCCCTGAGCGTTGCCGTCGGTCTGCTTGAGAGTTCCTTCCAGAACGCCGGAGGCCGCATCATGACCTTTACCAG
TGGTGCAGCAACTGAGGGCCCTGGCCACGTTGTTTCGCCTGAACTGAAGGAGCCTATTCGTTCGCACCACGATAT
TGAACGGGACAATATCAAATACTACAAGAAGGCTGTTAAGGTCGGTTCTCAACGCGTGAGTGTATTGGATTTTGC
TAATTTGCTCCTAGTTCTATGATGCCCTCGCTAAGCGCGCTGCCAACAATGGCCATATTGTCGATATTTTCGCCG
GCTGTCTTGATCAAGTCGGTTTGCTGGAAATGAAGAACCTCTCCAACTTTACTGGCGGTTACATGCTTCTCACCG
ATAGCTTCACATCCTCACAGTTCAAGCAATCGTTCGTGCGCGTGTTCGACAAGGACGCCGCCGATAACCTCTTGA
TGGGCTTCAATGCATCCCTCGAGGTGCTCACGACCAAGGAACTTAAGGTTACTGGTCTGATTGGGCATGCCATCT
CGCTGAACAAGAAGTCAAGCTCTGTTGGCGAGACAGAATGCGGTATCGGTAACACCTGTGCATGGAAGATGTGTG
GAATGGACCCATCCTCTAGCTACGGTATTTACTTTGAGATTGCCAACCAGGGCGGCCCAGCTGCTGTTCAGCCTG
GTCCTCAACGGGGTATGATTCAGTTTTTGACATACTACCAGCATTCCTCTGGGCATTATCACCTGCGAGTGACCA
CCACTGCCCGCCCCTTGAGCGGACCTGCAGGTGACCCAACCCTGGCACAATCCTTCGACCAAGAGGCTGCCGCTG
TCCTCATGGCCCGTATTGCAGTGTTCAAGGCGGAGGTTGATGACGGTCCAGACGTCCTGCGCTGGGTTGATCGTA
TGCTGATCAGACTCTGCTCCCGATTCGCTGACTACCGGAAAGATGACCCGACATCATTCCGATTGGAAAAGAACT
TCACCTTGTACCCTCAGTTCATGTTCCATCTCCGCCGAAGTCAGTTCTTGCAGGTTTTCAACAACTCGCCCGATG
AGACTGCTTTCTACCGCCACGTTTTGAACCACGAGGATACTGGTGACTCTCTTGTCATGATCCAGCCCACTCTTG
ATTCGTACTCTCTGGAGCAAGAGGGTGCTCAGCCAGTGCTGCTGGACTCCGCTTCTATCCAGCCCGCCCACATTC
TCCTCCTTGATACCTTCTTCCACATCCTGATCTTCAACGGCGAGACGATTGCCGAATGGAGGAAAGCCGGATACC
ATGAACAAGAGGGATACGAGAATCTCAAGTTGCTTCTTGAGCAGCCTAAAGAGGATGCTAGGGTTCGTTCCCACC
TTTCTTGTTGATCTTTAACCTATTTACTGACTGTGTATTATAGGATCTTATTTCCGACCGTTTCCCCCTGCCGCG
TTTCATCGTCTGCGATGCCGGTGGTTCCCAGGCGCGTTTCTTGCTGTCCAAGTTGAACCCGTCGACCACCCATAC
CACAGGTGGCTACGGTGGCGGTGTCTCATCGCAGACCATCTTCACTGATGACGTATCGCTCCAGACATTCATGGA
CCACCTGATGAAGTGAGTTTTCCTGCAATTCTGATGGATCCTTCCATGCTAATTTTATTCTAGACTTGCTGTATC
TGGAACCAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail