Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4317.t1
Gene name
Locationscaffold_08:669912..670735
Strand-
Gene length (bp)823
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00406 ADK Adenylate kinase 1.3E-19 16 95
PF00406 ADK Adenylate kinase 6.9E-13 120 227
PF05191 ADK_lid Adenylate kinase, active site lid 3.6E-15 164 199
PF13207 AAA_17 AAA domain 5.5E-09 17 86

GO

GO Term Description Terminal node
GO:0004017 adenylate kinase activity Yes
GO:0019205 nucleobase-containing compound kinase activity No
GO:0016776 phosphotransferase activity, phosphate group as acceptor No
GO:0003824 catalytic activity No
GO:0016301 kinase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0050145 nucleoside monophosphate kinase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4317.t1
MSHVTKQLRKAARIILIGAPGVGKGTQSERLLSRFPQLASISSGDLLRENVRLRTPLGLEAEATMQSGNLVPDSM
ILKLISDDMKSKGWLLPPLPSSPSATSSSSSSADTSSSAHTIDPSASFILDGFPRTATQAIALDSLVSVNFVVHI
ITPPSVILARIASRWVHEPSGRVYNTDFHPPKVPGRDDVTGEPLTQREDDSLDTWKQRLQKFEETSKSLLEHYDR
QGCLFHAEGNSSNEISPKLFAEVERRFC*
Coding >Pro_DTO377G3_2|g4317.t1
ATGTCGCATGTGACAAAGCAGCTCCGTAAGGCCGCGCGGATCATCTTGATTGGCGCGCCTGGAGTAGGAAAAGGG
ACACAGTCTGAGCGACTGCTATCCCGATTTCCACAGCTGGCTTCCATCAGCTCAGGTGATCTGTTGAGAGAAAAT
GTGCGCCTACGCACACCCCTCGGCCTGGAAGCCGAGGCCACAATGCAGTCCGGCAACCTTGTTCCCGACTCAATG
ATCCTGAAATTGATCTCCGATGATATGAAATCTAAGGGCTGGCTCCTCCCACCACTCCCATCCTCACCATCCGCA
ACATCCTCGTCATCTTCTTCAGCCGATACTTCCTCATCAGCCCACACAATCGATCCCTCTGCCTCATTTATTCTC
GACGGGTTTCCCCGTACCGCAACTCAGGCAATAGCCTTGGACAGCCTAGTATCGGTCAACTTTGTCGTGCACATA
ATCACCCCTCCATCAGTGATTCTCGCCCGCATCGCATCACGCTGGGTCCACGAGCCCTCAGGGCGCGTGTATAAT
ACAGACTTCCATCCACCAAAGGTGCCAGGCAGAGACGATGTCACGGGCGAGCCGCTGACGCAGCGAGAGGACGAT
TCTCTCGATACATGGAAGCAGCGTTTACAGAAGTTTGAGGAGACGAGCAAATCCCTCTTGGAGCACTATGACCGT
CAAGGGTGTCTATTCCATGCGGAGGGTAATAGCTCCAACGAAATTAGCCCAAAATTGTTCGCTGAGGTTGAGCGG
CGGTTCTGCTGA
Transcript >Pro_DTO377G3_2|g4317.t1
ATGTCGCATGTGACAAAGCAGCTCCGTAAGGCCGCGCGGATCATCTTGATTGGCGCGCCTGGAGTAGGAAAAGGG
ACACAGTCTGAGCGACTGCTATCCCGATTTCCACAGCTGGCTTCCATCAGCTCAGGTGATCTGTTGAGAGAAAAT
GTGCGCCTACGCACACCCCTCGGCCTGGAAGCCGAGGCCACAATGCAGTCCGGCAACCTTGTTCCCGACTCAATG
ATCCTGAAATTGATCTCCGATGATATGAAATCTAAGGGCTGGCTCCTCCCACCACTCCCATCCTCACCATCCGCA
ACATCCTCGTCATCTTCTTCAGCCGATACTTCCTCATCAGCCCACACAATCGATCCCTCTGCCTCATTTATTCTC
GACGGGTTTCCCCGTACCGCAACTCAGGCAATAGCCTTGGACAGCCTAGTATCGGTCAACTTTGTCGTGCACATA
ATCACCCCTCCATCAGTGATTCTCGCCCGCATCGCATCACGCTGGGTCCACGAGCCCTCAGGGCGCGTGTATAAT
ACAGACTTCCATCCACCAAAGGTGCCAGGCAGAGACGATGTCACGGGCGAGCCGCTGACGCAGCGAGAGGACGAT
TCTCTCGATACATGGAAGCAGCGTTTACAGAAGTTTGAGGAGACGAGCAAATCCCTCTTGGAGCACTATGACCGT
CAAGGGTGTCTATTCCATGCGGAGGGTAATAGCTCCAACGAAATTAGCCCAAAATTGTTCGCTGAGGTTGAGCGG
CGGTTCTGCTGA
Gene >Pro_DTO377G3_2|g4317.t1
ATGTCGCATGTGACAAAGCAGCTCCGTAAGGCCGCGCGGATCATCTTGATTGGCGCGCCTGGAGTAGGAAAAGGG
ACACAGTCTGAGCGACTGCTATCCCGATTTCCACAGCTGGCTTCCATCAGCTCAGGTGATCTGTTGAGAGAAAAT
GTGCGCCTACGCACACCCCTCGGTAAGTAGAATGAGCAACGGCGCAGTTTCGTACAGAGCAGAGATCTCTAACAT
AGTAATAGGCCTGGAAGCCGAGGCCACAATGCAGTCCGGCAACCTTGTTCCCGACTCAATGATCCTGAAATTGAT
CTCCGATGATATGAAATCTAAGGGCTGGCTCCTCCCACCACTCCCATCCTCACCATCCGCAACATCCTCGTCATC
TTCTTCAGCCGATACTTCCTCATCAGCCCACACAATCGATCCCTCTGCCTCATTTATTCTCGACGGGTTTCCCCG
TACCGCAACTCAGGCAATAGCCTTGGACAGCCTAGTATCGGTCAACTTTGTCGTGCACATAATCACCCCTCCATC
AGTGATTCTCGCCCGCATCGCATCACGCTGGGTCCACGAGCCCTCAGGGCGCGTGTATAATACAGACTTCCATCC
ACCAAAGGTGCCAGGCAGAGACGATGTCACGGGCGAGCCGCTGACGCAGCGAGAGGACGATTCTCTCGATACATG
GAAGCAGCGTTTACAGAAGTTTGAGGAGACGAGCAAATCCCTCTTGGAGCACTATGACCGTCAAGGGTGTCTATT
CCATGCGGAGGGTAATAGCTCCAACGAAATTAGCCCAAAATTGTTCGCTGAGGTTGAGCGGCGGTTCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail