Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g430.t1
Gene name
Locationscaffold_01:1090427..1092277
Strand-
Gene length (bp)1850
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.9E-09 67 131

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 284.69 175.28 394.10
5d_25C Five days - 25 degrees Celsius 298.44 184.08 412.80
7d_25C Seven days - 25 degrees Celsius 271.75 167.42 376.07
10d_25C Ten days - 25 degrees Celsius 302.89 185.27 420.51
7d_15C Seven days - 15 degrees Celsius 315.06 193.05 437.08
7d_30C Seven days - 30 degrees Celsius 286.36 176.28 396.43

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.879740 no
3d_25C 7d_25C 0.883314 no
3d_25C 7d_15C 0.722713 no
3d_25C 7d_30C 0.987217 no
3d_25C 10d_25C 0.842844 no
5d_25C 7d_25C 0.738555 no
5d_25C 7d_15C 0.863505 no
5d_25C 7d_30C 0.897418 no
5d_25C 10d_25C 0.964926 no
7d_25C 7d_15C 0.574597 no
7d_25C 7d_30C 0.867783 no
7d_25C 10d_25C 0.701591 no
7d_15C 7d_30C 0.738791 no
7d_15C 10d_25C 0.907210 no
7d_30C 10d_25C 0.857620 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g430.t1
MSANLDKSLDDLVGSRRQTARHTARRRGGSRRAATKAPTVGGVKKSTKATPKPAHPAPVAQTGSSKILVSGLPSD
VSEANVKSAGPVRRVMLTYNQNGTSRGIASIQFNRADTAAKATKELNGLLVDGRPMKIEVVYDASHVPVIPASKP
LTERIAQKARPKSAAAPKAKETKTPTEKTNRRGKGPARPRGRNAGRGKPKTVEELDAEMIDYFTNDAPPAEGTAP
VNGTVPQASASQDIGMADEIS*
Coding >Pro_DTO377G3_2|g430.t1
ATGTCTGCCAACCTTGATAAATCTCTTGACGATCTCGTCGGCAGCCGTCGCCAGACCGCTCGCCACACTGCTCGT
CGCCGTGGTGGTTCCCGCCGCGCAGCGACCAAGGCACCCACCGTTGGAGGTGTGAAGAAGTCTACCAAGGCGACT
CCTAAGCCTGCTCACCCGGCCCCTGTCGCCCAGACTGGATCCAGCAAGATTCTTGTCAGCGGATTGCCTTCCGAT
GTGTCCGAGGCCAATGTCAAGTCTGCTGGCCCCGTTAGGCGCGTCATGCTCACCTACAACCAGAATGGCACTAGC
CGTGGCATCGCCTCCATCCAATTTAACAGGGCTGACACTGCTGCCAAGGCTACCAAGGAGCTCAACGGACTCCTC
GTCGATGGCCGCCCCATGAAGATCGAAGTTGTCTATGATGCTTCTCACGTTCCTGTTATCCCTGCCTCCAAGCCT
CTTACTGAGCGCATTGCTCAGAAGGCTCGGCCCAAGTCCGCCGCTGCCCCCAAGGCCAAGGAAACCAAGACCCCT
ACTGAGAAGACAAACCGTCGTGGAAAGGGCCCTGCTCGCCCTCGTGGCCGCAACGCCGGCCGCGGAAAGCCCAAG
ACTGTCGAGGAGCTTGATGCTGAGATGATTGATTACTTCACCAACGATGCGCCCCCTGCCGAAGGCACTGCTCCT
GTCAACGGCACTGTCCCCCAGGCCAGCGCCAGCCAGGACATCGGCATGGCTGACGAAATCTCCTAA
Transcript >Pro_DTO377G3_2|g430.t1
ATGTCTGCCAACCTTGATAAATCTCTTGACGATCTCGTCGGCAGCCGTCGCCAGACCGCTCGCCACACTGCTCGT
CGCCGTGGTGGTTCCCGCCGCGCAGCGACCAAGGCACCCACCGTTGGAGGTGTGAAGAAGTCTACCAAGGCGACT
CCTAAGCCTGCTCACCCGGCCCCTGTCGCCCAGACTGGATCCAGCAAGATTCTTGTCAGCGGATTGCCTTCCGAT
GTGTCCGAGGCCAATGTCAAGTCTGCTGGCCCCGTTAGGCGCGTCATGCTCACCTACAACCAGAATGGCACTAGC
CGTGGCATCGCCTCCATCCAATTTAACAGGGCTGACACTGCTGCCAAGGCTACCAAGGAGCTCAACGGACTCCTC
GTCGATGGCCGCCCCATGAAGATCGAAGTTGTCTATGATGCTTCTCACGTTCCTGTTATCCCTGCCTCCAAGCCT
CTTACTGAGCGCATTGCTCAGAAGGCTCGGCCCAAGTCCGCCGCTGCCCCCAAGGCCAAGGAAACCAAGACCCCT
ACTGAGAAGACAAACCGTCGTGGAAAGGGCCCTGCTCGCCCTCGTGGCCGCAACGCCGGCCGCGGAAAGCCCAAG
ACTGTCGAGGAGCTTGATGCTGAGATGATTGATTACTTCACCAACGATGCGCCCCCTGCCGAAGGCACTGCTCCT
GTCAACGGCACTGTCCCCCAGGCCAGCGCCAGCCAGGACATCGGCATGGCTGACGAAATCTCCTAA
Gene >Pro_DTO377G3_2|g430.t1
ATGTCTGCCAACCTTGATAAATCTCTTGACGATCTCGTCGGCAGCCGTCGCCAGACCGCTCGCCACACTGCTCGT
CGCCGTGGTGGTTCCCGCCGCGCAGCGACCAAGGCACCCACCGTTGGAGGTGTGAAGAAGTCTACCAAGGCGACT
CCTAAGCCTGCTCACCCGGCCCCTGTCGCCCAGACTGGATCCAGCAAGATTCTTGTCAGCGGATTGGTAAGTTCT
TACTCATTGATGTTTCAGCTTGTCGCTAACCTCCTCAGCCTTCCGATGTGTCCGAGGCCAATGTCAAGGTATGTT
GATCTAAAGGCTCTCATATTGGCTTTCATCGCCATCTCTTTTCTCGAGACTCGCGGCGCAAACGATTTCGACCGG
TCTCTCGACTTCTCTCTACCTCCCACATCGATGGATATTCCTCGATGGACGGCACACACAGTTTGCTCCTTCTCC
ATGTCTCTGCAAATATATACACATTGCTGGCGCTCTGCGAGACAAGAAGTCAAACTGTGTTGTAGTACGGTGAAA
AGATGTACATTGCTCGTGTCAATTCCCATGCGGAAATCCACCTGCCTTGTTATCTGAGTACTATGCCGAGGATGA
TTGATGAAAATTCATCATCCTGACCTCTCTTCAATTCTGCTCATTTCCTTCATCTCTTCTACTTTGAAATCCTAC
GGGCATCAGCGAGCGCATCAGTGGAATAGTGGTCAACAGGTTCAGAGGGCAGACTGAAACCTACCTATTCGAGAC
TCTTGTCTCAAATCTCTCCGTAAAGAGTTCTGCTGCTATGGGGTGATTACCTATTCCAGTGACTCGGAGAAGTTT
AAACTGTGTCTGACATGGCACTACGTTGTTGGGATGACACATTCATGGACAAATGGATTTTAGTTGGAAAACTAT
GCCATGATGTCGGCGACGTGAAAGAATGCTTTTGTTGAAGGACCGCTTGATGGATGTATGGATGAAGTGGAGACT
TGATACTATGGATATTTGTTGGTGTGTTATGTTCCATTGCGGGAAGCAAATTTGCGACCTATCGCATGGGGTTGC
AATTAAGGAGCTATATGCTCCGTGGTCCAATGCCAGGATGAAACAGACGATGGATTGATGCTGTGTGCTCGCTGA
TGCTCTCTCACCTTTGGCCGTCCTCGTTTGCGCCGCCACCACTCGAGAACCGCGCTCACTGAAATTGTCTGACGA
AAATACTAATCGTCTTCGTTTGCGCTATAGGAATACTTCAACAAGTCTGCTGGCCCCGTTAGGCGCGTCATGCTC
ACCTACAACCAGAATGGCACTAGCCGTGGCATCGCCTCCATCCAATTTAACAGGGCTGACACTGCTGCCAAGGCT
ACCAAGGAGCTCAACGGACTCCTCGTCGATGGCCGCCCCATGAAGGTAAATCCTTTTTCTCTGGCTAGCCTTCAC
TGCAACATTGACTGACCTATATAACAGATCGAAGTTGTCTATGATGCTTCTCACGTTCCTGTTATCCCTGCCTCC
AAGCCTCTTACTGAGCGCATTGCGTAAGTTGATGTTCATTCTAGCTGTCCGCATCCATATGCTTATTCATTCACA
GTCAGAAGGCTCGGCCCAAGTCCGCCGCTGCCCCCAAGGCCAAGGAAACCAAGACCCCTACTGAGAAGACAAACC
GTCGTGGAAAGGGCCCTGCTCGCCCTCGTGGCCGCAACGCCGGCCGCGGAAAGCCCAAGACTGTCGAGGAGCTTG
ATGCTGAGATGATTGATTACTTCACCAACGATGCGCCCCCTGCCGAAGGCACTGCTCCTGTCAACGGCACTGTCC
CCCAGGCCAGCGCCAGCCAGGACATCGGCATGGCTGACGAAATCTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail