Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g43.t1
Gene name
Locationscaffold_01:102880..104602
Strand-
Gene length (bp)1722
Transcript length (bp)1665
Coding sequence length (bp)1665
Protein length (aa) 555

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 1.4E-51 9 347
PF11954 DUF3471 Domain of unknown function (DUF3471) 7.1E-17 430 532

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.23 0.00 0.57
5d_25C Five days - 25 degrees Celsius 0.82 0.00 1.64
7d_25C Seven days - 25 degrees Celsius 0.56 0.00 1.14
10d_25C Ten days - 25 degrees Celsius 1.79 0.35 3.24
7d_15C Seven days - 15 degrees Celsius 0.65 0.00 1.30
7d_30C Seven days - 30 degrees Celsius 1.82 0.34 3.29

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.106051 no
3d_25C 7d_25C 1.000000 no
3d_25C 7d_15C 1.000000 no
3d_25C 7d_30C 0.017204 yes
3d_25C 10d_25C 0.018034 yes
5d_25C 7d_25C 0.578654 no
5d_25C 7d_15C 0.754441 no
5d_25C 7d_30C 0.128640 no
5d_25C 10d_25C 0.138010 no
7d_25C 7d_15C 1.000000 no
7d_25C 7d_30C 0.024170 yes
7d_25C 10d_25C 0.027278 yes
7d_15C 7d_30C 0.044390 yes
7d_15C 10d_25C 0.047513 yes
7d_30C 10d_25C 0.986174 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g43.t1
MDLLHSAGFASHVTELIDQQHVPGLAIAIIHNDQIASAGYGHASLDPEIPCTADTLFDIASSAKSLTAAAVGLLV
ADNDMFPDIQYDAVMSTLLPEDFVMSGKGYTEGVSVEDILSHRSGMPSHNDSYMSVRAAKPDNARSITRNLRNLP
VAAPIRSKYIYCNMMYTVATHLVEVKSGQNFGTFLEERFFKPLDMASTTLQPSSARSKGFESRMATGYTWKRADS
TYRGLENPDCPEGQGAGSVISSVNDFIKFVKAFMNREDPINKNVYEGLTRLRTFVNPNPGRRKRHTSPVAYAAGL
DIYFYRGHMVVGHNGVFSGFGSRFFFLPDFSFGAVIMGNSDGANGVAATLVRKLIDNLLGVMDERPHDSKSKATR
PVKIRGPKPQAEVKDANPMSKNQGKKEKKKQEKKTQVKKSQDIQKGQVNEQRPKRHTPQPPTMPLSAYAGNYWNP
GYHNLLVQIRDDALFIDATDRSMGFTLKFEHVSDDRKFDAHLTDWLDGSDGIVKAEFVIEDAQVTRLGLQLEEML
KEMIWFEQKDGVKSEYLELRLTRNNNLDL*
Coding >Pro_DTO377G3_2|g43.t1
ATGGATCTTTTGCACTCGGCAGGGTTTGCGTCACATGTGACAGAGTTGATAGATCAGCAGCATGTCCCGGGGCTG
GCGATTGCAATCATACACAATGATCAAATTGCCTCTGCGGGATATGGACATGCGAGCCTGGATCCAGAAATACCT
TGCACAGCAGATACGCTGTTTGACATTGCATCGTCTGCTAAATCACTCACTGCTGCGGCGGTGGGATTGCTAGTC
GCCGATAATGACATGTTCCCGGATATTCAGTACGATGCTGTAATGTCGACTCTTCTCCCCGAGGACTTTGTTATG
TCTGGAAAAGGATACACAGAAGGAGTCAGCGTGGAAGACATCTTAAGTCATAGAAGTGGAATGCCTAGCCATAAC
GATTCTTATATGAGTGTGCGAGCGGCGAAGCCAGACAATGCTCGATCCATTACGAGAAACCTCAGGAATCTCCCT
GTCGCTGCTCCCATTCGATCAAAGTATATTTACTGCAACATGATGTATACAGTGGCAACCCATCTTGTGGAAGTC
AAGAGCGGACAGAATTTTGGTACATTCCTCGAAGAGCGATTTTTCAAGCCTCTGGACATGGCATCAACTACTCTT
CAACCCAGCAGCGCACGATCAAAAGGATTCGAATCCCGCATGGCAACTGGCTACACATGGAAAAGAGCCGACTCA
ACATATCGTGGGTTAGAAAATCCGGACTGCCCAGAAGGCCAAGGCGCAGGGTCTGTCATTTCGAGCGTGAACGAC
TTCATCAAATTTGTCAAGGCTTTTATGAATCGCGAAGACCCTATCAATAAAAATGTTTATGAAGGACTCACTCGC
CTGCGAACTTTTGTGAATCCAAACCCAGGAAGACGGAAGCGGCACACCTCACCGGTAGCATATGCTGCTGGTCTG
GATATCTACTTTTACAGGGGACATATGGTCGTCGGCCATAATGGGGTATTCTCTGGATTCGGAAGTCGCTTCTTC
TTTCTCCCTGATTTCTCATTCGGTGCTGTGATCATGGGAAACTCAGATGGGGCAAATGGCGTTGCGGCGACCCTT
GTCCGAAAGCTAATTGACAATCTCCTTGGAGTCATGGACGAAAGACCTCATGACAGCAAAAGCAAAGCCACAAGA
CCTGTTAAAATTCGCGGTCCAAAACCCCAGGCCGAGGTGAAAGATGCAAATCCAATGAGTAAGAACCAGGGAAAG
AAGGAGAAGAAAAAGCAGGAAAAGAAAACCCAAGTGAAAAAAAGTCAAGATATCCAGAAGGGCCAAGTGAATGAA
CAAAGACCAAAAAGGCATACTCCGCAGCCACCGACAATGCCTCTCAGTGCTTACGCTGGCAACTACTGGAATCCT
GGGTATCATAACTTATTGGTCCAAATCAGAGATGATGCGCTCTTCATCGATGCTACAGATCGCTCAATGGGGTTT
ACCTTGAAATTCGAGCATGTGTCCGATGACCGAAAATTCGATGCTCATCTTACTGATTGGCTCGATGGCAGTGAT
GGCATCGTAAAAGCGGAGTTTGTAATAGAAGATGCTCAAGTCACAAGGTTGGGTCTGCAGTTGGAGGAAATGCTC
AAGGAAATGATCTGGTTCGAGCAGAAGGATGGAGTAAAGAGTGAGTATCTTGAATTGAGGCTGACAAGGAATAAT
AATTTGGATTTATAA
Transcript >Pro_DTO377G3_2|g43.t1
ATGGATCTTTTGCACTCGGCAGGGTTTGCGTCACATGTGACAGAGTTGATAGATCAGCAGCATGTCCCGGGGCTG
GCGATTGCAATCATACACAATGATCAAATTGCCTCTGCGGGATATGGACATGCGAGCCTGGATCCAGAAATACCT
TGCACAGCAGATACGCTGTTTGACATTGCATCGTCTGCTAAATCACTCACTGCTGCGGCGGTGGGATTGCTAGTC
GCCGATAATGACATGTTCCCGGATATTCAGTACGATGCTGTAATGTCGACTCTTCTCCCCGAGGACTTTGTTATG
TCTGGAAAAGGATACACAGAAGGAGTCAGCGTGGAAGACATCTTAAGTCATAGAAGTGGAATGCCTAGCCATAAC
GATTCTTATATGAGTGTGCGAGCGGCGAAGCCAGACAATGCTCGATCCATTACGAGAAACCTCAGGAATCTCCCT
GTCGCTGCTCCCATTCGATCAAAGTATATTTACTGCAACATGATGTATACAGTGGCAACCCATCTTGTGGAAGTC
AAGAGCGGACAGAATTTTGGTACATTCCTCGAAGAGCGATTTTTCAAGCCTCTGGACATGGCATCAACTACTCTT
CAACCCAGCAGCGCACGATCAAAAGGATTCGAATCCCGCATGGCAACTGGCTACACATGGAAAAGAGCCGACTCA
ACATATCGTGGGTTAGAAAATCCGGACTGCCCAGAAGGCCAAGGCGCAGGGTCTGTCATTTCGAGCGTGAACGAC
TTCATCAAATTTGTCAAGGCTTTTATGAATCGCGAAGACCCTATCAATAAAAATGTTTATGAAGGACTCACTCGC
CTGCGAACTTTTGTGAATCCAAACCCAGGAAGACGGAAGCGGCACACCTCACCGGTAGCATATGCTGCTGGTCTG
GATATCTACTTTTACAGGGGACATATGGTCGTCGGCCATAATGGGGTATTCTCTGGATTCGGAAGTCGCTTCTTC
TTTCTCCCTGATTTCTCATTCGGTGCTGTGATCATGGGAAACTCAGATGGGGCAAATGGCGTTGCGGCGACCCTT
GTCCGAAAGCTAATTGACAATCTCCTTGGAGTCATGGACGAAAGACCTCATGACAGCAAAAGCAAAGCCACAAGA
CCTGTTAAAATTCGCGGTCCAAAACCCCAGGCCGAGGTGAAAGATGCAAATCCAATGAGTAAGAACCAGGGAAAG
AAGGAGAAGAAAAAGCAGGAAAAGAAAACCCAAGTGAAAAAAAGTCAAGATATCCAGAAGGGCCAAGTGAATGAA
CAAAGACCAAAAAGGCATACTCCGCAGCCACCGACAATGCCTCTCAGTGCTTACGCTGGCAACTACTGGAATCCT
GGGTATCATAACTTATTGGTCCAAATCAGAGATGATGCGCTCTTCATCGATGCTACAGATCGCTCAATGGGGTTT
ACCTTGAAATTCGAGCATGTGTCCGATGACCGAAAATTCGATGCTCATCTTACTGATTGGCTCGATGGCAGTGAT
GGCATCGTAAAAGCGGAGTTTGTAATAGAAGATGCTCAAGTCACAAGGTTGGGTCTGCAGTTGGAGGAAATGCTC
AAGGAAATGATCTGGTTCGAGCAGAAGGATGGAGTAAAGAGTGAGTATCTTGAATTGAGGCTGACAAGGAATAAT
AATTTGGATTTATAA
Gene >Pro_DTO377G3_2|g43.t1
ATGGATCTTTTGCACTCGGCAGGGTTTGCGTCACATGTGACAGAGTTGATAGATCAGCAGCATGTCCCGGGGCTG
GCGATTGCAATCATACACAATGATCAAATTGCCTCTGCGGGATATGGACATGCGAGCCTGGATCCAGAAATACCT
TGCACAGCAGATACGCTGTTTGACATTGCATCGTCTGCTAAATCACTCACTGCTGCGGCGGTGGGATTGCTAGTC
GCCGATAATGACATGTTCCCGGATATTCAGTACGATGCTGTAATGTCGACTCTTCTCCCCGAGGACTTTGTTATG
TCTGGAAAAGGATACACAGAAGGAGTCAGCGTGGAAGACATCTTAAGTCATAGAAGTGGAATGCCTAGGTGAGCT
AGTTTTTTCAAATTTCATGGTTGAGTTCAAGACTAATGATATTGCGCCAGCCATAACGATTCTTATATGAGTGTG
CGAGCGGCGAAGCCAGACAATGCTCGATCCATTACGAGAAACCTCAGGAATCTCCCTGTCGCTGCTCCCATTCGA
TCAAAGTATATTTACTGCAACATGATGTATACAGTGGCAACCCATCTTGTGGAAGTCAAGAGCGGACAGAATTTT
GGTACATTCCTCGAAGAGCGATTTTTCAAGCCTCTGGACATGGCATCAACTACTCTTCAACCCAGCAGCGCACGA
TCAAAAGGATTCGAATCCCGCATGGCAACTGGCTACACATGGAAAAGAGCCGACTCAACATATCGTGGGTTAGAA
AATCCGGACTGCCCAGAAGGCCAAGGCGCAGGGTCTGTCATTTCGAGCGTGAACGACTTCATCAAATTTGTCAAG
GCTTTTATGAATCGCGAAGACCCTATCAATAAAAATGTTTATGAAGGACTCACTCGCCTGCGAACTTTTGTGAAT
CCAAACCCAGGAAGACGGAAGCGGCACACCTCACCGGTAGCATATGCTGCTGGTCTGGATATCTACTTTTACAGG
GGACATATGGTCGTCGGCCATAATGGGGTATTCTCTGGATTCGGAAGTCGCTTCTTCTTTCTCCCTGATTTCTCA
TTCGGTGCTGTGATCATGGGAAACTCAGATGGGGCAAATGGCGTTGCGGCGACCCTTGTCCGAAAGCTAATTGAC
AATCTCCTTGGAGTCATGGACGAAAGACCTCATGACAGCAAAAGCAAAGCCACAAGACCTGTTAAAATTCGCGGT
CCAAAACCCCAGGCCGAGGTGAAAGATGCAAATCCAATGAGTAAGAACCAGGGAAAGAAGGAGAAGAAAAAGCAG
GAAAAGAAAACCCAAGTGAAAAAAAGTCAAGATATCCAGAAGGGCCAAGTGAATGAACAAAGACCAAAAAGGCAT
ACTCCGCAGCCACCGACAATGCCTCTCAGTGCTTACGCTGGCAACTACTGGAATCCTGGGTATCATAACTTATTG
GTCCAAATCAGAGATGATGCGCTCTTCATCGATGCTACAGATCGCTCAATGGGGTTTACCTTGAAATTCGAGCAT
GTGTCCGATGACCGAAAATTCGATGCTCATCTTACTGATTGGCTCGATGGCAGTGATGGCATCGTAAAAGCGGAG
TTTGTAATAGAAGATGCTCAAGTCACAAGGTTGGGTCTGCAGTTGGAGGAAATGCTCAAGGAAATGATCTGGTTC
GAGCAGAAGGATGGAGTAAAGAGTGAGTATCTTGAATTGAGGCTGACAAGGAATAATAATTTGGATTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail