Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4290.t1
Gene name
Locationscaffold_08:597534..600386
Strand+
Gene length (bp)2852
Transcript length (bp)2739
Coding sequence length (bp)2739
Protein length (aa) 913

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00654 Voltage_CLC Voltage gated chloride channel 3.1E-88 350 723

GO

GO Term Description Terminal node
GO:0005247 voltage-gated chloride channel activity Yes
GO:0016020 membrane Yes
GO:0006821 chloride transport Yes
GO:0055085 transmembrane transport Yes
GO:0022803 passive transmembrane transporter activity No
GO:0008308 voltage-gated anion channel activity No
GO:0008509 anion transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0022839 ion gated channel activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0022838 substrate-specific channel activity No
GO:0005253 anion channel activity No
GO:0015075 ion transmembrane transporter activity No
GO:0022836 gated channel activity No
GO:0006820 anion transport No
GO:0022832 voltage-gated channel activity No
GO:0015698 inorganic anion transport No
GO:0005216 ion channel activity No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0015108 chloride transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0005254 chloride channel activity No
GO:0008150 biological_process No
GO:0015267 channel activity No
GO:0003674 molecular_function No
GO:0006811 ion transport No
GO:0005244 voltage-gated ion channel activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 194 212 18
2 265 287 22
3 366 388 22
4 398 415 17
5 428 450 22
6 500 522 22
7 542 564 22
8 602 619 17
9 626 648 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4290.t1
MPRSLPKSSFASREQDDTENVRVPQTAPPSPSIYRRSQSYLSETHTEYQSLDAPFEVTETTSLLGPAQAFRRRGP
RRSYTSTSGVSDTGPDSFRHVLAAGSLRRTLNHSRANSMSRGFSRRGSMDGDSRPASLPPSMKDNLTASSFLDER
TWYDQFTSTDWVHDSIADGARLRLLRQRKDVRGRLLAAFDGAQGWILVALIGCITASIAYFVDVTEGSVFDLKEG
FCTTRIFRNRRTCCEGLAACDAWRSWSRIFSPSGTESQWVDFVIFVFWVVALALISCALTLLTKTVVPSSISLAT
LDENLGADPRGTKSGNGLGASDSPLSETETSPLHGTLPNYPSRPAMIYYSAAGSGVAEVKVINSGFVLHGYLGLK
TLVIKTIGLIFSVSSGLSLGKEGPYVHIATCVGNICCRLFAKYNKNDGKRREVLSASAASGVAVAFGAPIGGVLF
SLEEVSYYFPPKTLFRTFFCCIAATLSLKFLNPYGTGKIVLFEVRYLSDWQIFEIFIFILLGIMGGAAGALFIKA
SNLWARSFRRIPAIKRWPMLEVFLVALFTGLVSFWNRYTRLAVTELLFELASPCESDVESTGLCPRTDGILEIVQ
DLLVAFVIKSFLTIITFGIKVPAGIYVPSMVVGGLMGRIVGHLIQYWALRHPTFFLFDSCPAVAGIESCVTPGVY
ALVAAGATMCGVTRLSVTLPVILFELTGSLNHVLPFSLSVLCAKWTADAIEPRSIYDLLTDMNSYPFLDSKLQPT
TDALLGDIVRPVRKNRIIDISASPFLPATDLRLKLEHLLMAGELDSGLPILRDGVLAGLIPAPDLEYALDTLGEE
EENTICLMAMDASSAVLDSDNEDADEVDFSQFIDPAPIALDVHSPIDLVYQCFAKLGLRYLCVTRDGKYAGLVHK
KAFVKFMKENSD*
Coding >Pro_DTO377G3_2|g4290.t1
ATGCCTCGCTCCCTTCCAAAGTCCAGTTTTGCCTCGCGCGAACAGGACGACACCGAAAACGTGCGCGTTCCCCAA
ACAGCTCCTCCCTCACCGAGTATCTACAGACGATCTCAAAGCTACCTCTCCGAAACACATACCGAATACCAGTCC
CTCGATGCGCCGTTCGAGGTTACAGAAACAACGAGCCTCCTTGGGCCCGCCCAAGCCTTCCGCCGACGAGGTCCG
CGACGGTCTTACACCAGCACCTCCGGGGTTTCGGACACCGGTCCGGACTCATTTAGACACGTTCTGGCGGCTGGT
AGCCTGCGGCGGACGCTAAATCATAGCCGTGCCAACTCCATGAGTAGGGGGTTCAGCCGGCGAGGGAGCATGGAC
GGCGACAGCAGACCCGCTAGTCTTCCTCCGTCTATGAAGGACAATCTTACTGCCTCTTCATTTCTGGATGAACGG
ACTTGGTATGATCAATTCACTTCCACAGATTGGGTGCATGACAGTATCGCCGATGGAGCGCGGCTTCGCCTACTC
CGTCAGCGGAAAGATGTGCGAGGCCGATTGCTGGCGGCTTTCGACGGTGCGCAAGGATGGATCTTGGTCGCGCTC
ATTGGGTGCATCACGGCCTCCATTGCTTACTTCGTCGATGTCACCGAAGGATCGGTCTTTGATCTGAAGGAAGGC
TTCTGCACGACCCGGATTTTCCGCAATCGAAGGACGTGCTGTGAAGGGCTGGCTGCTTGTGATGCGTGGCGGTCC
TGGTCGAGGATCTTCTCACCATCGGGTACAGAAAGCCAGTGGGTTGACTTTGTCATTTTTGTCTTTTGGGTTGTG
GCATTAGCTCTCATATCGTGTGCTTTGACTCTACTCACAAAGACTGTTGTTCCTTCTTCCATTTCTCTTGCGACG
CTTGATGAAAACCTGGGCGCTGACCCCCGTGGTACAAAATCTGGGAATGGCCTTGGTGCCTCGGATTCTCCTCTT
TCGGAGACAGAGACAAGCCCACTACATGGAACTTTGCCTAATTATCCGTCCCGTCCAGCTATGATCTACTACTCT
GCTGCTGGCAGTGGAGTGGCAGAAGTCAAAGTCATTAACAGTGGTTTTGTCCTTCATGGATATCTGGGCTTGAAG
ACACTAGTCATTAAAACCATTGGCTTGATTTTTAGTGTTTCGTCTGGTTTGAGCTTAGGCAAAGAAGGCCCATAC
GTTCATATTGCTACCTGCGTGGGCAATATCTGTTGTCGTCTGTTCGCCAAGTATAACAAAAACGATGGAAAGCGA
CGAGAGGTTCTGAGTGCCAGTGCCGCTAGTGGTGTTGCTGTTGCCTTTGGTGCTCCGATTGGCGGCGTCCTCTTC
AGCTTGGAAGAAGTCAGCTATTATTTCCCACCCAAAACCCTTTTCCGGACGTTCTTTTGTTGTATTGCAGCTACG
TTGTCCCTCAAGTTCCTAAACCCCTATGGAACAGGCAAGATCGTTTTATTCGAAGTCCGGTACCTTTCAGACTGG
CAAATCTTCGAGATTTTCATTTTCATCCTTCTCGGTATTATGGGAGGCGCCGCTGGTGCGCTCTTCATCAAAGCC
TCGAATCTATGGGCACGATCATTCCGTCGCATTCCAGCTATCAAGCGCTGGCCAATGCTTGAGGTTTTCCTCGTT
GCGTTGTTTACGGGTCTTGTCAGTTTCTGGAATCGGTACACCAGGCTTGCTGTCACCGAACTTCTATTTGAGCTA
GCTTCTCCGTGTGAATCAGATGTGGAAAGTACGGGCCTCTGTCCCCGCACTGACGGCATTCTTGAAATTGTCCAG
GACCTTCTGGTGGCGTTTGTCATCAAGAGTTTCTTGACCATTATTACGTTCGGCATCAAAGTTCCTGCGGGAATC
TACGTGCCATCTATGGTTGTTGGTGGCTTGATGGGGCGAATTGTTGGACATTTGATCCAGTACTGGGCTCTTAGA
CACCCGACTTTTTTCTTATTCGACTCTTGCCCTGCAGTTGCTGGAATTGAGTCGTGCGTGACTCCAGGAGTCTAC
GCATTGGTTGCCGCTGGAGCGACCATGTGCGGCGTGACAAGACTGTCGGTTACATTGCCTGTGATCCTGTTCGAA
TTGACAGGAAGTCTCAACCACGTGCTTCCTTTTTCGCTGTCGGTGCTCTGCGCTAAGTGGACTGCGGATGCCATT
GAACCTCGCAGCATTTATGATCTCTTGACCGACATGAACTCCTACCCCTTCCTTGATAGCAAACTCCAACCGACC
ACCGATGCCTTGCTGGGGGATATAGTCCGACCAGTGCGGAAGAATCGCATCATCGATATCTCTGCATCACCATTT
TTGCCAGCCACAGACCTCCGTTTGAAACTGGAACACCTGCTCATGGCAGGCGAGCTAGACAGCGGACTTCCTATT
CTACGGGACGGTGTCCTAGCTGGTCTGATCCCGGCACCGGATCTCGAGTACGCACTAGATACGCTGGGCGAGGAA
GAAGAAAATACGATCTGTCTGATGGCCATGGACGCTTCTTCAGCCGTCTTGGACAGCGATAACGAGGATGCCGAC
GAGGTGGATTTCAGTCAATTCATTGACCCTGCTCCAATCGCTCTTGATGTTCATTCCCCTATCGATCTGGTCTAC
CAATGCTTCGCCAAGCTAGGTCTTCGTTACCTCTGCGTTACTCGGGACGGAAAATATGCCGGCCTGGTACACAAG
AAAGCATTCGTGAAATTCATGAAGGAGAATAGCGACTAG
Transcript >Pro_DTO377G3_2|g4290.t1
ATGCCTCGCTCCCTTCCAAAGTCCAGTTTTGCCTCGCGCGAACAGGACGACACCGAAAACGTGCGCGTTCCCCAA
ACAGCTCCTCCCTCACCGAGTATCTACAGACGATCTCAAAGCTACCTCTCCGAAACACATACCGAATACCAGTCC
CTCGATGCGCCGTTCGAGGTTACAGAAACAACGAGCCTCCTTGGGCCCGCCCAAGCCTTCCGCCGACGAGGTCCG
CGACGGTCTTACACCAGCACCTCCGGGGTTTCGGACACCGGTCCGGACTCATTTAGACACGTTCTGGCGGCTGGT
AGCCTGCGGCGGACGCTAAATCATAGCCGTGCCAACTCCATGAGTAGGGGGTTCAGCCGGCGAGGGAGCATGGAC
GGCGACAGCAGACCCGCTAGTCTTCCTCCGTCTATGAAGGACAATCTTACTGCCTCTTCATTTCTGGATGAACGG
ACTTGGTATGATCAATTCACTTCCACAGATTGGGTGCATGACAGTATCGCCGATGGAGCGCGGCTTCGCCTACTC
CGTCAGCGGAAAGATGTGCGAGGCCGATTGCTGGCGGCTTTCGACGGTGCGCAAGGATGGATCTTGGTCGCGCTC
ATTGGGTGCATCACGGCCTCCATTGCTTACTTCGTCGATGTCACCGAAGGATCGGTCTTTGATCTGAAGGAAGGC
TTCTGCACGACCCGGATTTTCCGCAATCGAAGGACGTGCTGTGAAGGGCTGGCTGCTTGTGATGCGTGGCGGTCC
TGGTCGAGGATCTTCTCACCATCGGGTACAGAAAGCCAGTGGGTTGACTTTGTCATTTTTGTCTTTTGGGTTGTG
GCATTAGCTCTCATATCGTGTGCTTTGACTCTACTCACAAAGACTGTTGTTCCTTCTTCCATTTCTCTTGCGACG
CTTGATGAAAACCTGGGCGCTGACCCCCGTGGTACAAAATCTGGGAATGGCCTTGGTGCCTCGGATTCTCCTCTT
TCGGAGACAGAGACAAGCCCACTACATGGAACTTTGCCTAATTATCCGTCCCGTCCAGCTATGATCTACTACTCT
GCTGCTGGCAGTGGAGTGGCAGAAGTCAAAGTCATTAACAGTGGTTTTGTCCTTCATGGATATCTGGGCTTGAAG
ACACTAGTCATTAAAACCATTGGCTTGATTTTTAGTGTTTCGTCTGGTTTGAGCTTAGGCAAAGAAGGCCCATAC
GTTCATATTGCTACCTGCGTGGGCAATATCTGTTGTCGTCTGTTCGCCAAGTATAACAAAAACGATGGAAAGCGA
CGAGAGGTTCTGAGTGCCAGTGCCGCTAGTGGTGTTGCTGTTGCCTTTGGTGCTCCGATTGGCGGCGTCCTCTTC
AGCTTGGAAGAAGTCAGCTATTATTTCCCACCCAAAACCCTTTTCCGGACGTTCTTTTGTTGTATTGCAGCTACG
TTGTCCCTCAAGTTCCTAAACCCCTATGGAACAGGCAAGATCGTTTTATTCGAAGTCCGGTACCTTTCAGACTGG
CAAATCTTCGAGATTTTCATTTTCATCCTTCTCGGTATTATGGGAGGCGCCGCTGGTGCGCTCTTCATCAAAGCC
TCGAATCTATGGGCACGATCATTCCGTCGCATTCCAGCTATCAAGCGCTGGCCAATGCTTGAGGTTTTCCTCGTT
GCGTTGTTTACGGGTCTTGTCAGTTTCTGGAATCGGTACACCAGGCTTGCTGTCACCGAACTTCTATTTGAGCTA
GCTTCTCCGTGTGAATCAGATGTGGAAAGTACGGGCCTCTGTCCCCGCACTGACGGCATTCTTGAAATTGTCCAG
GACCTTCTGGTGGCGTTTGTCATCAAGAGTTTCTTGACCATTATTACGTTCGGCATCAAAGTTCCTGCGGGAATC
TACGTGCCATCTATGGTTGTTGGTGGCTTGATGGGGCGAATTGTTGGACATTTGATCCAGTACTGGGCTCTTAGA
CACCCGACTTTTTTCTTATTCGACTCTTGCCCTGCAGTTGCTGGAATTGAGTCGTGCGTGACTCCAGGAGTCTAC
GCATTGGTTGCCGCTGGAGCGACCATGTGCGGCGTGACAAGACTGTCGGTTACATTGCCTGTGATCCTGTTCGAA
TTGACAGGAAGTCTCAACCACGTGCTTCCTTTTTCGCTGTCGGTGCTCTGCGCTAAGTGGACTGCGGATGCCATT
GAACCTCGCAGCATTTATGATCTCTTGACCGACATGAACTCCTACCCCTTCCTTGATAGCAAACTCCAACCGACC
ACCGATGCCTTGCTGGGGGATATAGTCCGACCAGTGCGGAAGAATCGCATCATCGATATCTCTGCATCACCATTT
TTGCCAGCCACAGACCTCCGTTTGAAACTGGAACACCTGCTCATGGCAGGCGAGCTAGACAGCGGACTTCCTATT
CTACGGGACGGTGTCCTAGCTGGTCTGATCCCGGCACCGGATCTCGAGTACGCACTAGATACGCTGGGCGAGGAA
GAAGAAAATACGATCTGTCTGATGGCCATGGACGCTTCTTCAGCCGTCTTGGACAGCGATAACGAGGATGCCGAC
GAGGTGGATTTCAGTCAATTCATTGACCCTGCTCCAATCGCTCTTGATGTTCATTCCCCTATCGATCTGGTCTAC
CAATGCTTCGCCAAGCTAGGTCTTCGTTACCTCTGCGTTACTCGGGACGGAAAATATGCCGGCCTGGTACACAAG
AAAGCATTCGTGAAATTCATGAAGGAGAATAGCGACTAG
Gene >Pro_DTO377G3_2|g4290.t1
ATGCCTCGCTCCCTTCCAAAGTCCAGTTTTGCCTCGCGCGAACAGGACGACACCGAAAACGTGCGCGTTCCCCAA
ACAGCTCCTCCCTCACCGAGTATCTACAGACGATCTCAAAGCTACCTCTCCGAAACACATACCGAATACCAGTCC
CTCGATGCGCCGTTCGAGGTTACAGAAACAACGAGCCTCCTTGGGCCCGCCCAAGCCTTCCGCCGACGAGGTCCG
CGACGGTCTTACACCAGCACCTCCGGGGTTTCGGACACCGGTCCGGACTCATTTAGACACGTTCTGGCGGCTGGT
AGCCTGCGGCGGACGCTAAATCATAGCCGTGCCAACTCCATGAGTAGGGGGTTCAGCCGGCGAGGGAGCATGGAC
GGCGACAGCAGACCCGCTAGTCTTCCTCCGTCTATGAAGGACAATCTTACTGCCTCTTCATTTCTGGATGAACGG
ACTTGGTATGATCAATTCACTTCCACAGATTGGGTGCATGACAGTATCGCCGATGGAGCGCGGCTTCGCCTACTC
CGTCAGCGGAAAGATGTGCGAGGCCGATTGCTGGCGGCTTTCGACGGTGCGCAAGGATGGATCTTGGTCGCGCTC
ATTGGGTGCATCACGGCCTCCATTGCTTACTTCGTCGATGTCACCGAAGGATCGGTCTTTGATCTGAAGGAAGGC
TTCTGCACGACCCGGATTTTCCGCAATCGAAGGACGTGCTGTGAAGGGCTGGCTGCTTGTGATGCGTGGCGGTCC
TGGTCGAGGATCTTCTCACCATCGGGTACAGAAAGCCAGTGGGTTGACTTTGTCATTTTTGTCTTTTGGGTTGTG
GCATTAGCTCTCATATCGTGTGCTTTGACTCTACTCACAAAGACTGTTGTTCCTTCTTCCATTTCTCTTGCGACG
CTTGATGAAAACCTGGGCGCTGACCCCCGTGGTACAAAATCTGGGAATGGCCTTGGTGCCTCGGATTCTCCTCTT
TCGGAGACAGAGACAAGCCCACTACATGGAACTTTGCCTAATTATCCGTCCCGTCCAGCTATGATCTACTACTCT
GCTGCTGGCAGTGGAGTGGCAGAAGTCAAAGTCATTAACAGTGGTTTTGTCCTTCATGGATATCTGGGCTTGAAG
ACACTAGTCATTAAAACCATTGGCTTGATTTTTAGTGTTTCGTCTGGTTTGAGCTTAGGCAAAGAAGGCCCATAC
GTTCATATTGCTACCTGCGTGGGCAATATCTGTTGTCGTCTGTTCGCCAAGTATAACAAAAACGATGGAAAGCGA
CGAGAGGTTCTGAGTGCCAGTGCCGCTAGTGGTGTTGCTGTTGCCTTTGGTGCTCCGATTGGCGGCGTCCTCTTC
AGCTTGGAAGAAGTCAGCTATTATTTCCCACCCAAAACCCTTTTCCGGACGTTCTTTTGTTGTATTGCAGCTACG
TTGTCCCTCAAGTTCCTAAACCCCTATGGAACAGGCAAGATCGTTTTATTCGAAGTCCGGTACCTTTCAGACTGG
CAAATCTTCGAGATTTTCATTTTCATCCTTCTCGGTATTATGGGAGGCGCCGCTGGTGCGCTCTTCATCAAAGCC
TCGAATCTATGGGCACGATCATTCCGTCGCATTCCAGCTATCAAGCGCTGGCCAATGCTTGAGGTTTTCCTCGTT
GCGTTGTTTACGGGTCTTGTCAGTTTCTGGAATCGGTACACCAGGCTTGCTGTCACCGAACTTCTATTTGAGCTA
GCTTCTCCGTGTGAATCAGATGTGGAAAGTACGGGCCTCTGTCCCCGCACTGACGGCATTCTTGAAATTGTCCAG
GACCTTCTGGTGGCGTTTGTCATCAAGAGTTTCTTGACCATTATTACGTTCGGCATCAAAGTTCCTGCGGGAATC
TACGTGCCATCTATGGTTGTTGGTGGCTTGATGGGGCGAATTGTTGGACATTTGATCCAGTACTGGGCTCTTAGA
CACCCGACTTTTTTCTTATTCGACTCTTGCCCTGCAGTTGCTGGAATTGAGTCGTGCGTGACTCCAGGAGTCTAC
GCATTGGTTGCCGCTGGAGCGACCATGTGCGGCGTGACAAGACTGTCGGTTACATTGCCTGTGATCCTGTTCGAA
TTGACAGGAAGTCTCAACCACGTGCTTCCTTTTTCGCTGTCGGTGCTCTGCGCTAAGTGGACTGCGGATGCCATT
GAACCTCGCAGCATTTATGTAAGTTTTGAGATCCGCCTCGTAACTTAAATTTGACATTATACTAATTGAAACCAG
GATCTCTTGACCGACATGAACTCCTACCCCTTCCTTGATAGCAAACTCCAACCGACCACCGATGCCTTGCTGGGG
GATATAGTCCGACCAGTGCGGAAGAATCGCATCATCGATATCTCTGCATCACCATTTTTGCCAGCCACAGACCTC
CGTTTGAAACTGGAACACCTGCTCATGGCAGGCGAGCTAGACAGCGGACTTCCTATTCTACGGGACGGTGTCCTA
GCTGGTCTGATCCCGGCACCGGATCTCGAGTACGCACTAGATACGCTGGGCGAGGAAGAAGAAAATACGATCTGT
CTGATGGCCATGGACGCTTCTTCAGCCGTCTTGGACAGCGATAACGAGGATGCCGACGAGGTGGATTTCAGTCAA
TTCATTGACCCTGTAAGTTTGGTTAACTTCTTCAATATCTTGGCCCATACTAATTTGTTTATACATAGGCTCCAA
TCGCTCTTGATGTTCATTCCCCTATCGATCTGGTCTACCAATGCTTCGCCAAGCTAGGTCTTCGTTACCTCTGCG
TTACTCGGGACGGAAAATATGCCGGCCTGGTACACAAGAAAGCATTCGTGAAATTCATGAAGGAGAATAGCGACT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail