Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4250.t1
Gene name
Locationscaffold_08:467764..471951
Strand-
Gene length (bp)4187
Transcript length (bp)4080
Coding sequence length (bp)4080
Protein length (aa) 1360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 9.8E-81 1029 1281
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 1.2E-24 235 301
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.6E-06 607 931
PF13246 Cation_ATPase Cation transport ATPase (P-type) 3.5E-10 694 780

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 495 517 22
2 547 569 22
3 1100 1122 22
4 1143 1165 22
5 1180 1202 22
6 1209 1231 22
7 1244 1266 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4250.t1
MASGRPPGSHPAAGRDDDLLLDPGPEYNSGQGPPVNDEHLLERYNIDDSEEPYTQTQPRPSVSYDNFVGSSAQQG
ATQQNAPSRPAHPPANIGLHSNDPYSSGMRDRSYSQTSGLDNYRRYSLDDFDDGHSGYYDLDADEERIASSHHVR
KANERNSVLGLGGGLMGKAKYMFGMGSSQYSEMDLPLTESGARRGTVGSDASPAPPPKQRKKFHVSDLNIFARKV
DPSTLGPRMIQLNNPPANATHRFVNNFVSTAKYNIFTFIPKFLFEQFSKYANLFFLFTAVLQQIPNVSPTNKFTT
IVPLAIVLAVSAIKELVEDYKRRMSDRGLNYSKTQVLKGSSFHDAKWVDVVVGDIVRVESEQPFPADLVLLASSE
PEGLCYIETANLDGETNLKIKQAIPETAHLVSPSDLSRLSGRVRSEQPNSSLYTYEATLTMNAGGGEKELPLAPD
QLLLRGATLRNTPWIHGIVVFSGHETKLMRNATATPIKRTAVERTVNIQILMLVSILIVLSVISSVGDLAIRRTR
SSSLAYLDYGSVKVVKQFFMDIFTYWVLYSNLVPISLFVTIEIVKYFQAFLINSDLDIYYDKTDTPAICRTSSLV
EELGQIEYIFSDKTGTLTCNMMEFKQVSIAGIQYGDDVPEDRRAAMEDDAEVGIYDFKKLRENLQSHPSQNAIRE
FLTLLATCHTVIPERNSDDPNVIKYQAASPDEGALVDGAASLGFRFTNRRPRSVIFEAGGQELEYELLAVCEFNS
TRKRMSTIFRCPDGKVRVYCKGADTVIIERLHPDNPTVEATLQHLEEYASDGLRTLCLAMREVPENEFQQWYQIY
DKASTTVDGSRADELDKAAELIEKDFYLLGATAIEDRLQDGVPDTIHTLQTAGIKIWVLTGDRQETAINIGMSCK
LISEDMTLLIINEESSEATRDSLQKKMDAVQSQIVSGDSEPLALVIDGRSLTFALEKDMEKLFLDLAVICKAVVC
CRVSPLQKALVVKLVKRHKKALLLAIGDGANDVSMIQAAHVGVGISGVEGLQAARSADVAIGQFRFLRKLLLVHG
AWSYSRISRVILYSYYKNITLYMTQFWYSFQNAFSGEVIYESWTLSFYNVLFTVLPPFAMGIFDQFISARLLDRY
PQLYQLGQRGVFFQKHSFWAWILNGFFHSLILYIVSQLLFYWDLPMADGQVAGHWVWGEALYTAVLGTVLGKAAL
ITNIWTKYTFIAIPGSMALWLIFLPAYGYAAPALGFSREYYGTIPVVFKSPIFYLMAIVLPCICLLRDYAWKYAK
RMYYPQQYHHVQEIQKYNVQDYRPRMEQFQKAIRKVRQVQRMRKQRGYAFSQADDGGQMRVLSAYDTTRSRGRYG
EMASSRPMV*
Coding >Pro_DTO377G3_2|g4250.t1
ATGGCCAGCGGTAGGCCTCCTGGGTCGCATCCAGCCGCTGGCCGCGATGACGACCTGCTGTTGGATCCTGGACCT
GAGTATAACAGTGGTCAAGGCCCCCCCGTCAATGATGAACACCTATTAGAACGCTACAACATTGACGACTCTGAA
GAACCGTACACCCAAACACAACCGCGCCCTTCTGTTTCCTATGATAACTTTGTCGGATCCAGCGCACAGCAGGGC
GCAACGCAGCAAAATGCTCCTTCTAGACCGGCGCATCCGCCTGCCAACATCGGTCTCCATTCCAATGACCCCTAC
TCCAGCGGCATGCGAGATCGGTCCTACTCCCAGACTTCTGGACTGGACAATTATCGGCGGTATTCTTTGGATGAC
TTCGACGATGGGCACTCGGGTTATTATGATCTCGACGCGGACGAAGAACGAATTGCCAGTTCACACCACGTCCGC
AAGGCAAATGAGCGCAACAGCGTTCTCGGACTCGGGGGTGGATTGATGGGCAAGGCGAAATACATGTTTGGCATG
GGGTCATCGCAATATTCGGAAATGGATCTTCCGTTGACCGAGTCAGGCGCAAGAAGGGGAACAGTTGGGAGCGAT
GCTTCTCCAGCGCCACCCCCGAAGCAACGCAAGAAGTTCCACGTGTCAGACCTTAATATCTTTGCACGCAAGGTT
GATCCCTCGACACTGGGCCCGCGCATGATTCAGCTCAACAACCCGCCTGCCAATGCCACTCACAGGTTCGTCAAC
AACTTCGTATCGACGGCCAAGTACAACATCTTTACCTTCATTCCGAAATTCCTCTTCGAGCAATTCTCCAAATAT
GCCAACTTGTTCTTCTTGTTTACCGCTGTTCTGCAACAAATCCCCAATGTGTCGCCGACAAATAAGTTCACGACT
ATCGTTCCGCTGGCCATCGTCTTGGCAGTGTCGGCGATCAAAGAATTGGTAGAGGACTACAAACGGAGAATGTCG
GACAGAGGACTGAATTACTCGAAAACACAAGTTCTTAAGGGATCTTCGTTCCACGATGCAAAATGGGTGGATGTT
GTGGTCGGGGATATAGTTAGGGTTGAGTCCGAGCAGCCTTTTCCGGCCGACTTGGTACTATTGGCGTCATCTGAG
CCTGAAGGTCTATGCTACATTGAAACGGCAAACCTGGATGGTGAGACCAATCTTAAAATCAAGCAAGCCATTCCG
GAGACTGCGCATCTGGTCAGCCCCAGTGATCTGAGTCGTCTGAGCGGACGCGTTCGATCGGAACAGCCAAATAGC
AGTCTGTATACTTACGAAGCCACCTTGACTATGAATGCTGGAGGTGGCGAGAAAGAGTTACCCTTGGCTCCGGAT
CAACTCCTACTTCGTGGTGCAACGCTGCGCAACACTCCCTGGATTCATGGAATCGTGGTTTTTAGTGGCCACGAG
ACAAAACTGATGCGAAATGCGACAGCAACCCCGATCAAGCGAACAGCCGTGGAGCGAACAGTCAACATTCAAATT
TTGATGCTTGTTAGCATTCTCATCGTTCTGAGTGTCATCAGTTCTGTCGGTGATCTTGCTATTCGGAGGACCAGA
TCTTCATCGCTTGCATACCTCGACTATGGGTCGGTCAAAGTGGTAAAGCAGTTTTTTATGGACATTTTCACGTAC
TGGGTGCTCTATTCGAATTTGGTTCCGATTTCCCTCTTCGTCACCATTGAAATCGTCAAATACTTCCAAGCCTTC
CTCATCAACTCCGACCTCGACATTTACTACGATAAAACTGACACCCCGGCCATATGCCGCACATCCTCCCTTGTC
GAAGAGCTTGGTCAGATTGAGTACATCTTCTCCGACAAAACAGGCACCCTTACCTGCAACATGATGGAGTTTAAG
CAAGTTAGCATTGCCGGTATCCAATATGGCGATGATGTTCCCGAAGACCGACGTGCTGCCATGGAGGATGATGCT
GAAGTTGGGATTTATGATTTCAAGAAACTCAGAGAGAACCTTCAATCGCACCCAAGCCAGAACGCTATTCGCGAA
TTTCTCACTCTCCTTGCCACCTGTCACACTGTTATTCCTGAGCGAAACAGCGATGACCCAAATGTGATCAAGTAC
CAAGCAGCGTCGCCGGATGAGGGAGCCTTGGTAGATGGGGCCGCCTCGCTGGGTTTCCGATTCACCAACAGAAGA
CCAAGATCGGTGATCTTTGAGGCTGGTGGACAGGAGCTTGAATACGAACTGCTAGCAGTGTGCGAGTTCAACTCT
ACTAGAAAACGAATGTCCACTATTTTCCGGTGTCCAGATGGAAAGGTCCGCGTCTACTGTAAGGGTGCTGACACG
GTTATTATTGAGCGGCTGCATCCCGATAACCCTACCGTGGAAGCAACTCTCCAGCACCTGGAGGAGTACGCCTCA
GATGGTCTACGGACCTTGTGTCTGGCTATGCGGGAAGTTCCAGAAAACGAGTTCCAGCAATGGTACCAGATCTAT
GACAAGGCTTCTACAACTGTCGACGGCAGCCGCGCGGATGAACTGGACAAAGCGGCCGAACTGATTGAAAAGGAT
TTCTATCTTCTTGGCGCCACGGCTATTGAGGATCGCTTGCAGGATGGTGTTCCGGATACTATCCACACCCTCCAG
ACTGCAGGTATCAAGATTTGGGTCTTGACTGGTGACCGACAGGAGACTGCAATCAACATCGGCATGTCTTGCAAA
CTTATTTCGGAAGACATGACGCTTCTCATCATCAACGAGGAGTCGTCAGAAGCCACCCGTGACAGCTTGCAAAAG
AAAATGGACGCCGTACAGAGTCAAATTGTCTCTGGGGACTCCGAACCTTTAGCTTTGGTAATTGACGGGCGGTCG
TTGACTTTTGCATTGGAGAAAGACATGGAGAAGCTATTCCTGGATTTGGCTGTCATTTGCAAAGCCGTTGTTTGT
TGTCGGGTCTCTCCCCTTCAAAAGGCTTTGGTCGTCAAGCTTGTCAAGCGCCACAAGAAGGCTCTCCTCTTGGCC
ATTGGCGACGGTGCCAATGATGTGTCCATGATTCAAGCCGCTCATGTCGGAGTCGGTATCAGCGGTGTCGAAGGC
CTTCAGGCCGCACGATCTGCTGATGTCGCAATTGGCCAGTTCAGGTTCCTTCGAAAGTTGCTTTTGGTTCACGGA
GCGTGGAGCTATTCTCGTATCAGTCGAGTCATTCTGTACTCATACTATAAGAACATTACGCTGTATATGACTCAG
TTCTGGTATTCTTTCCAAAACGCATTCTCCGGAGAGGTTATCTACGAATCGTGGACGCTCTCCTTCTACAACGTC
CTCTTCACTGTCCTGCCTCCATTCGCGATGGGAATCTTTGACCAGTTCATCTCCGCCCGATTGCTCGACCGCTAC
CCACAGCTATACCAGCTAGGTCAGAGAGGTGTATTCTTCCAGAAGCACAGCTTTTGGGCCTGGATTCTGAATGGA
TTCTTCCACTCTCTCATCCTCTACATTGTCTCTCAGTTGCTCTTCTACTGGGACCTTCCTATGGCAGATGGCCAG
GTTGCCGGCCACTGGGTCTGGGGTGAAGCTCTTTACACCGCCGTGCTAGGTACCGTTCTCGGCAAAGCTGCTCTG
ATAACCAACATTTGGACCAAGTACACCTTCATTGCTATCCCAGGATCAATGGCCCTGTGGCTCATCTTCCTCCCG
GCATACGGTTACGCCGCCCCAGCCTTGGGTTTCTCGCGAGAATACTACGGCACCATTCCCGTGGTCTTCAAGTCC
CCTATCTTCTACTTGATGGCTATCGTCCTACCCTGTATATGCCTCCTACGTGATTATGCCTGGAAGTACGCCAAG
CGCATGTACTACCCACAACAATACCACCATGTCCAGGAAATTCAGAAATACAATGTCCAGGACTACCGTCCACGC
ATGGAACAGTTCCAAAAAGCCATCCGGAAAGTCCGCCAGGTCCAGCGCATGCGTAAGCAGCGCGGCTACGCCTTC
TCCCAGGCCGACGATGGCGGCCAGATGCGTGTTCTCAGTGCTTACGACACTACCAGGAGTCGTGGACGCTATGGT
GAGATGGCTAGCTCAAGGCCTATGGTGTGA
Transcript >Pro_DTO377G3_2|g4250.t1
ATGGCCAGCGGTAGGCCTCCTGGGTCGCATCCAGCCGCTGGCCGCGATGACGACCTGCTGTTGGATCCTGGACCT
GAGTATAACAGTGGTCAAGGCCCCCCCGTCAATGATGAACACCTATTAGAACGCTACAACATTGACGACTCTGAA
GAACCGTACACCCAAACACAACCGCGCCCTTCTGTTTCCTATGATAACTTTGTCGGATCCAGCGCACAGCAGGGC
GCAACGCAGCAAAATGCTCCTTCTAGACCGGCGCATCCGCCTGCCAACATCGGTCTCCATTCCAATGACCCCTAC
TCCAGCGGCATGCGAGATCGGTCCTACTCCCAGACTTCTGGACTGGACAATTATCGGCGGTATTCTTTGGATGAC
TTCGACGATGGGCACTCGGGTTATTATGATCTCGACGCGGACGAAGAACGAATTGCCAGTTCACACCACGTCCGC
AAGGCAAATGAGCGCAACAGCGTTCTCGGACTCGGGGGTGGATTGATGGGCAAGGCGAAATACATGTTTGGCATG
GGGTCATCGCAATATTCGGAAATGGATCTTCCGTTGACCGAGTCAGGCGCAAGAAGGGGAACAGTTGGGAGCGAT
GCTTCTCCAGCGCCACCCCCGAAGCAACGCAAGAAGTTCCACGTGTCAGACCTTAATATCTTTGCACGCAAGGTT
GATCCCTCGACACTGGGCCCGCGCATGATTCAGCTCAACAACCCGCCTGCCAATGCCACTCACAGGTTCGTCAAC
AACTTCGTATCGACGGCCAAGTACAACATCTTTACCTTCATTCCGAAATTCCTCTTCGAGCAATTCTCCAAATAT
GCCAACTTGTTCTTCTTGTTTACCGCTGTTCTGCAACAAATCCCCAATGTGTCGCCGACAAATAAGTTCACGACT
ATCGTTCCGCTGGCCATCGTCTTGGCAGTGTCGGCGATCAAAGAATTGGTAGAGGACTACAAACGGAGAATGTCG
GACAGAGGACTGAATTACTCGAAAACACAAGTTCTTAAGGGATCTTCGTTCCACGATGCAAAATGGGTGGATGTT
GTGGTCGGGGATATAGTTAGGGTTGAGTCCGAGCAGCCTTTTCCGGCCGACTTGGTACTATTGGCGTCATCTGAG
CCTGAAGGTCTATGCTACATTGAAACGGCAAACCTGGATGGTGAGACCAATCTTAAAATCAAGCAAGCCATTCCG
GAGACTGCGCATCTGGTCAGCCCCAGTGATCTGAGTCGTCTGAGCGGACGCGTTCGATCGGAACAGCCAAATAGC
AGTCTGTATACTTACGAAGCCACCTTGACTATGAATGCTGGAGGTGGCGAGAAAGAGTTACCCTTGGCTCCGGAT
CAACTCCTACTTCGTGGTGCAACGCTGCGCAACACTCCCTGGATTCATGGAATCGTGGTTTTTAGTGGCCACGAG
ACAAAACTGATGCGAAATGCGACAGCAACCCCGATCAAGCGAACAGCCGTGGAGCGAACAGTCAACATTCAAATT
TTGATGCTTGTTAGCATTCTCATCGTTCTGAGTGTCATCAGTTCTGTCGGTGATCTTGCTATTCGGAGGACCAGA
TCTTCATCGCTTGCATACCTCGACTATGGGTCGGTCAAAGTGGTAAAGCAGTTTTTTATGGACATTTTCACGTAC
TGGGTGCTCTATTCGAATTTGGTTCCGATTTCCCTCTTCGTCACCATTGAAATCGTCAAATACTTCCAAGCCTTC
CTCATCAACTCCGACCTCGACATTTACTACGATAAAACTGACACCCCGGCCATATGCCGCACATCCTCCCTTGTC
GAAGAGCTTGGTCAGATTGAGTACATCTTCTCCGACAAAACAGGCACCCTTACCTGCAACATGATGGAGTTTAAG
CAAGTTAGCATTGCCGGTATCCAATATGGCGATGATGTTCCCGAAGACCGACGTGCTGCCATGGAGGATGATGCT
GAAGTTGGGATTTATGATTTCAAGAAACTCAGAGAGAACCTTCAATCGCACCCAAGCCAGAACGCTATTCGCGAA
TTTCTCACTCTCCTTGCCACCTGTCACACTGTTATTCCTGAGCGAAACAGCGATGACCCAAATGTGATCAAGTAC
CAAGCAGCGTCGCCGGATGAGGGAGCCTTGGTAGATGGGGCCGCCTCGCTGGGTTTCCGATTCACCAACAGAAGA
CCAAGATCGGTGATCTTTGAGGCTGGTGGACAGGAGCTTGAATACGAACTGCTAGCAGTGTGCGAGTTCAACTCT
ACTAGAAAACGAATGTCCACTATTTTCCGGTGTCCAGATGGAAAGGTCCGCGTCTACTGTAAGGGTGCTGACACG
GTTATTATTGAGCGGCTGCATCCCGATAACCCTACCGTGGAAGCAACTCTCCAGCACCTGGAGGAGTACGCCTCA
GATGGTCTACGGACCTTGTGTCTGGCTATGCGGGAAGTTCCAGAAAACGAGTTCCAGCAATGGTACCAGATCTAT
GACAAGGCTTCTACAACTGTCGACGGCAGCCGCGCGGATGAACTGGACAAAGCGGCCGAACTGATTGAAAAGGAT
TTCTATCTTCTTGGCGCCACGGCTATTGAGGATCGCTTGCAGGATGGTGTTCCGGATACTATCCACACCCTCCAG
ACTGCAGGTATCAAGATTTGGGTCTTGACTGGTGACCGACAGGAGACTGCAATCAACATCGGCATGTCTTGCAAA
CTTATTTCGGAAGACATGACGCTTCTCATCATCAACGAGGAGTCGTCAGAAGCCACCCGTGACAGCTTGCAAAAG
AAAATGGACGCCGTACAGAGTCAAATTGTCTCTGGGGACTCCGAACCTTTAGCTTTGGTAATTGACGGGCGGTCG
TTGACTTTTGCATTGGAGAAAGACATGGAGAAGCTATTCCTGGATTTGGCTGTCATTTGCAAAGCCGTTGTTTGT
TGTCGGGTCTCTCCCCTTCAAAAGGCTTTGGTCGTCAAGCTTGTCAAGCGCCACAAGAAGGCTCTCCTCTTGGCC
ATTGGCGACGGTGCCAATGATGTGTCCATGATTCAAGCCGCTCATGTCGGAGTCGGTATCAGCGGTGTCGAAGGC
CTTCAGGCCGCACGATCTGCTGATGTCGCAATTGGCCAGTTCAGGTTCCTTCGAAAGTTGCTTTTGGTTCACGGA
GCGTGGAGCTATTCTCGTATCAGTCGAGTCATTCTGTACTCATACTATAAGAACATTACGCTGTATATGACTCAG
TTCTGGTATTCTTTCCAAAACGCATTCTCCGGAGAGGTTATCTACGAATCGTGGACGCTCTCCTTCTACAACGTC
CTCTTCACTGTCCTGCCTCCATTCGCGATGGGAATCTTTGACCAGTTCATCTCCGCCCGATTGCTCGACCGCTAC
CCACAGCTATACCAGCTAGGTCAGAGAGGTGTATTCTTCCAGAAGCACAGCTTTTGGGCCTGGATTCTGAATGGA
TTCTTCCACTCTCTCATCCTCTACATTGTCTCTCAGTTGCTCTTCTACTGGGACCTTCCTATGGCAGATGGCCAG
GTTGCCGGCCACTGGGTCTGGGGTGAAGCTCTTTACACCGCCGTGCTAGGTACCGTTCTCGGCAAAGCTGCTCTG
ATAACCAACATTTGGACCAAGTACACCTTCATTGCTATCCCAGGATCAATGGCCCTGTGGCTCATCTTCCTCCCG
GCATACGGTTACGCCGCCCCAGCCTTGGGTTTCTCGCGAGAATACTACGGCACCATTCCCGTGGTCTTCAAGTCC
CCTATCTTCTACTTGATGGCTATCGTCCTACCCTGTATATGCCTCCTACGTGATTATGCCTGGAAGTACGCCAAG
CGCATGTACTACCCACAACAATACCACCATGTCCAGGAAATTCAGAAATACAATGTCCAGGACTACCGTCCACGC
ATGGAACAGTTCCAAAAAGCCATCCGGAAAGTCCGCCAGGTCCAGCGCATGCGTAAGCAGCGCGGCTACGCCTTC
TCCCAGGCCGACGATGGCGGCCAGATGCGTGTTCTCAGTGCTTACGACACTACCAGGAGTCGTGGACGCTATGGT
GAGATGGCTAGCTCAAGGCCTATGGTGTGA
Gene >Pro_DTO377G3_2|g4250.t1
ATGGCCAGCGGTAGGCCTCCTGGGTCGCATCCAGCCGCTGGCCGCGATGACGACCTGCTGTTGGATCCTGGACCT
GAGTATAACAGTGGTCAAGGCCCCCCCGTCAATGATGAACACCTATTAGAACGCTACAACATTGACGACTCTGAA
GAACCGTACACCCAAACACAACCGCGCCCTTCTGTTTCCTATGATAACTTTGTCGGATCCAGCGCACAGCAGGGC
GCAACGCAGCAAAATGCTCCTTCTAGACCGGCGCATCCGCCTGCCAACATCGGTCTCCATTCCAATGACCCCTAC
TCCAGCGGCATGCGAGATCGGTCCTACTCCCAGACTTCTGGACTGGACAATTATCGGCGGTATTCTTTGGATGAC
TTCGACGATGGGCACTCGGGTTATTATGATCTCGACGCGGACGAAGAACGAATTGCCAGTTCACACCACGTCCGC
AAGGCAAATGAGCGCAACAGCGTTCTCGGACTCGGGGGTGGATTGATGGGCAAGGCGAAATACATGTTTGGCATG
GGGTCATCGCAATATTCGGAAATGGATCTTCCGTTGACCGAGTCAGGCGCAAGAAGGGGAACAGTTGGGAGCGAT
GCTTCTCCAGCGCCACCCCCGAAGCAACGCAAGAAGTTCCACGTGTCAGACCTTAATATCTTTGCACGCAAGGTT
GATCCCTCGACACTGGGCCCGCGCATGATTCAGCTCAACAACCCGCCTGCCAATGCCACTCACAGGTTCGTCAAC
AACTTCGTATCGACGGCCAAGTACAACATCTTTACCTTCATTCCGAAATTCCTCTTCGAGCAATTCTCCAAATAT
GCCAACTTGTTCTTCTTGTTTACCGCTGTTCTGCAACAAATCCCCAATGTGTCGCCGACAAATAAGTTCACGACT
ATCGTTCCGCTGGCCATCGTCTTGGCAGTGTCGGCGATCAAAGAATTGGTAGAGGACTACAAACGGAGAATGTCG
GACAGAGGACTGAATTACTCGAAAACACAAGTTCTTAAGGGATCTTCGTTCCACGATGCAAAATGGGTGGATGTT
GTGGTCGGGGATATAGTTAGGGTTGAGTCCGAGCAGCCTTTTCCGGCCGACTTGGTACTATTGGCGTCATCTGAG
CCTGAAGGTCTATGCTACATTGAAACGGCAAACCTGGATGGTGAGACCAATCTTAAAATCAAGCAAGCCATTCCG
GAGACTGCGCATCTGGTCAGCCCCAGTGATCTGAGTCGTCTGAGCGGACGCGTTCGATCGGAACAGCCAAATAGC
AGTCTGTATACTTACGAAGCCACCTTGACTATGAATGCTGGAGGTGGCGAGAAAGAGTTACCCTTGGCTCCGGAT
CAACTCCTACTTCGTGGTGCAACGCTGCGCAACACTCCCTGGATTCATGGAATCGTGGTTTTTAGTGGCCACGAG
ACAAAACTGATGCGAAATGCGACAGCAACCCCGATCAAGCGAACAGCCGTGGAGCGAACAGTCAACATTCAAATT
TTGATGCTTGTTAGCATTCTCATCGTTCTGAGTGTCATCAGTTCTGTCGGTGATCTTGCTATTCGGAGGACCAGA
TCTTCATCGCTTGCATACCTCGACTATGGGTCGGTCAAAGTGGTAAAGCAGTTTTTTATGGACATTTTCACGTAC
TGGGTGCTCTATTCGAATTTGGTTCCGATTTCCCTCTTCGTCACCATTGAAATCGTCAAATACTTCCAAGCCTTC
CTCATCAACTCCGACCTCGACATTTACTACGATAAAACTGACACCCCGGCCATATGCCGCACATCCTCCCTTGTC
GAAGAGCTTGGTCAGATTGAGTACATCTTCTCCGACAAAACAGGCACCCTTACCTGCAACATGATGGAGTTTAAG
CAAGTTAGCATTGCCGGTATCCAATATGGCGATGATGTTCCCGAAGACCGACGTGCTGCCATGGAGGATGATGCT
GAAGTTGGGATTTATGATTTCAAGAAACTCAGAGAGAACCTTCAATCGCACCCAAGCCAGAACGCTATTCGCGAA
TTTCTCACTCTCCTTGCCACCTGTCACACTGTTATTCCTGAGCGAAACAGCGATGACCCAAATGTGATCAAGTAC
CAAGCAGCGTCGCCGGATGAGGGAGCCTTGGTAGATGGGGCCGCCTCGCTGGGTTTCCGATTCACCAACAGAAGA
CCAAGATCGGTGATCTTTGAGGCTGGTGGACAGGAGCTTGAATACGAACTGCTAGCAGTGTGCGAGTTCAACTCT
ACTAGAAAACGAATGTCCACTATTTTCCGGTGTCCAGATGGAAAGGTCCGCGTCTACTGTAAGGGTGCTGACACG
GTTATTATTGAGCGGCTGCATCCCGATAACCCTACCGTGGAAGCAACTCTCCAGCACCTGGAGGAGTACGCCTCA
GATGGTCTACGGACCTTGTGTCTGGCTATGCGGGAAGTTCCAGAAAACGAGTTCCAGCAATGGTACCAGATCTAT
GACAAGGCTTCTACAACTGTCGACGGCAGCCGCGCGGATGAACTGGACAAAGCGGCCGAACTGATTGAAAAGGAT
TTCTATCTTCTTGGCGCCACGGCTATTGAGGATCGCTTGCAGGATGGTGTTCCGGATACTATCCACACCCTCCAG
ACTGCAGGTATCAAGATTTGGGTCTTGACTGGTGACCGACAGGAGACTGCAATCAACATCGGCATGTCTTGCAAA
CTTATTTCGGAAGACATGACGCTTCTCATCATCAACGAGGAGTCGTCAGAAGCCACCCGTGACAGCTTGCAAAAG
AAAATGGACGCCGTACAGAGTCAAATTGTCTCTGGGGACTCCGAACCTTTAGCTTTGGTAATTGACGGGCGGTCG
TTGACTTTTGCATTGGAGAAAGACATGGAGAAGCTATTCCTGGATTTGGCTGTCATTTGCAAAGCCGTTGTTTGT
TGGTAAGTGCGCCGTTGAATTTTTGGAGGATTATATTTTTGTTCTAACATGCTCTTTAGTCGGGTCTCTCCCCTT
CAAAAGGCTTTGGTCGTCAAGCTTGTCAAGCGCCACAAGAAGGCTCTCCTCTTGGCCATTGGCGACGGTGCCAAT
GATGTGTCCATGATTCAAGCCGCTCATGTCGGAGTCGGTATCAGCGGTGTCGAAGGCCTTCAGGCCGCACGATCT
GCTGATGTCGCAATTGGCCAGTTCAGGTTCCTTCGAAAGTTGCTTTTGGTTCACGGAGCGTGGAGCTATTCTCGT
ATCAGTCGAGTCATTCTGTACTCATACTATAAGAACATTACGCTGTATATGACTCAGTTCTGGGTAAGTCCAAAC
TTGAGGAGTCATTTGGAGTGGTACCTGACTTGTTACAGTATTCTTTCCAAAACGCATTCTCCGGAGAGGTTATCT
ACGAATCGTGGACGCTCTCCTTCTACAACGTCCTCTTCACTGTCCTGCCTCCATTCGCGATGGGAATCTTTGACC
AGTTCATCTCCGCCCGATTGCTCGACCGCTACCCACAGCTATACCAGCTAGGTCAGAGAGGTGTATTCTTCCAGA
AGCACAGCTTTTGGGCCTGGATTCTGAATGGATTCTTCCACTCTCTCATCCTCTACATTGTCTCTCAGTTGCTCT
TCTACTGGGACCTTCCTATGGCAGATGGCCAGGTTGCCGGCCACTGGGTCTGGGGTGAAGCTCTTTACACCGCCG
TGCTAGGTACCGTTCTCGGCAAAGCTGCTCTGATAACCAACATTTGGACCAAGTACACCTTCATTGCTATCCCAG
GATCAATGGCCCTGTGGCTCATCTTCCTCCCGGCATACGGTTACGCCGCCCCAGCCTTGGGTTTCTCGCGAGAAT
ACTACGGCACCATTCCCGTGGTCTTCAAGTCCCCTATCTTCTACTTGATGGCTATCGTCCTACCCTGTATATGCC
TCCTACGTGATTATGCCTGGAAGTACGCCAAGCGCATGTACTACCCACAACAATACCACCATGTCCAGGAAATTC
AGAAATACAATGTCCAGGACTACCGTCCACGCATGGAACAGTTCCAAAAAGCCATCCGGAAAGTCCGCCAGGTCC
AGCGCATGCGTAAGCAGCGCGGCTACGCCTTCTCCCAGGCCGACGATGGCGGCCAGATGCGTGTTCTCAGTGCTT
ACGACACTACCAGGAGTCGTGGACGCTATGGTGAGATGGCTAGCTCAAGGCCTATGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail