Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4249.t1
Gene name
Locationscaffold_08:465286..467272
Strand+
Gene length (bp)1986
Transcript length (bp)1986
Coding sequence length (bp)1986
Protein length (aa) 662

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda 9.3E-21 386 434
PF14791 DNA_pol_B_thumb DNA polymerase beta thumb 1.3E-19 588 659
PF14792 DNA_pol_B_palm DNA polymerase beta palm 1.2E-16 437 581
PF14716 HHH_8 Helix-hairpin-helix domain 1.8E-09 290 353

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0005634 nucleus Yes
GO:0034061 DNA polymerase activity Yes
GO:0003676 nucleic acid binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016779 nucleotidyltransferase activity No
GO:0044464 cell part No
GO:0043227 membrane-bounded organelle No
GO:0043226 organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0044424 intracellular part No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4249.t1
MIADKSSSSKDKTEHVSLFSTQPPIFILPMHLSLEELDEIEGRLIDYGGRLTYDIAEAGLVLGKVGRVKRAALEL
RTRGVWTEELIPSSTPKSIGGGGEPPLKRRRTDQYDGINDVPVEIIDLSTESEGEDGATNQHDPSKQQIAEKKAE
AIENSITVLKLEWLDTSITSGRCVSQDPFVVYRGRKIPSPPTTVSENKQDLLKQKSNQIIQRAKEDAGVPTPRAP
PPDHIHARRSKEPPDRSSQHPRPTLYRKTTSEHEMDESNAPSQPDWVRDQVIFACLRSAPLHPPNEDFILQLVKI
RRIRELTIDKIGVRAYSTAIAALAAYPYPIQRPSEILALPGCNAKIADLFAQFQQHGGCEHTDDDGNVAAADSLE
KDPILRVLNSFFQIWGVGAKTAREFYQRGWRDLDDIVEHGWDTLSRVQQIGVKFYEEFQEGIPRAESEGIATVIQ
DHAARVRAEDANGIECVIVGGYRRGKQVSGDVDVILSHRDDAVTRNLIVDLVASLEAERYITHTLSLHLTSSLRE
QQTLPFHGDDTRKFDTLDKALVVWQDPHFDATAVEHNDRQVKNPNIHRRVDIIISPWRTVGCAILGWSGDLTFQR
DLRRYAKKARFLKFDSSGVRDRGTGRQVDLEEDGETWEEREKLVMEGLGIGWRPPEERCSR*
Coding >Pro_DTO377G3_2|g4249.t1
ATGATCGCAGATAAGAGCTCTTCTTCAAAAGACAAGACAGAACATGTCTCCCTCTTCTCAACCCAACCTCCCATC
TTCATTTTGCCAATGCATCTCTCCCTAGAGGAGCTGGACGAGATTGAAGGCCGATTGATAGATTATGGCGGAAGA
CTTACCTATGATATTGCCGAAGCTGGTCTCGTTTTGGGAAAAGTCGGGCGCGTGAAGCGTGCAGCGCTGGAACTG
CGCACCCGCGGTGTCTGGACAGAGGAGCTCATACCCAGCTCAACTCCAAAATCAATTGGCGGTGGCGGCGAGCCC
CCTCTCAAGCGCAGGCGCACAGATCAGTACGACGGAATCAATGATGTCCCGGTTGAGATTATCGATCTCAGTACC
GAGTCTGAAGGCGAGGATGGAGCTACGAATCAACATGATCCATCAAAGCAGCAGATCGCAGAGAAAAAGGCAGAA
GCAATTGAAAATTCAATCACAGTACTGAAGCTCGAGTGGCTGGATACCTCTATCACATCCGGCAGATGTGTTTCC
CAAGACCCATTCGTTGTCTACCGTGGGCGAAAGATCCCTTCTCCCCCAACGACAGTGTCAGAAAATAAGCAAGAC
TTACTTAAACAGAAATCAAATCAAATAATCCAGCGTGCAAAGGAAGATGCTGGTGTACCAACGCCACGAGCTCCT
CCTCCGGACCACATTCATGCACGGCGCTCAAAAGAACCCCCTGACAGATCTTCCCAGCACCCCCGACCGACGCTA
TACCGAAAGACAACCTCGGAACATGAAATGGATGAATCTAACGCACCCTCACAACCAGACTGGGTCCGTGACCAA
GTCATATTCGCATGCCTGCGCTCAGCACCCTTACACCCTCCAAACGAAGATTTTATCTTGCAACTCGTGAAAATA
AGACGTATTCGCGAACTCACCATCGACAAGATCGGCGTGCGCGCATATAGTACCGCCATCGCAGCATTGGCAGCA
TACCCATATCCCATCCAACGGCCGAGCGAGATCCTCGCTTTACCCGGGTGCAACGCCAAGATTGCGGACTTGTTC
GCGCAGTTCCAACAACATGGTGGCTGCGAGCATACCGACGACGACGGGAACGTTGCCGCTGCCGACTCGCTGGAG
AAAGATCCTATTCTCCGGGTTCTGAACTCGTTCTTTCAGATATGGGGTGTTGGGGCTAAGACAGCACGCGAGTTT
TACCAGCGTGGGTGGCGCGACCTCGATGATATTGTCGAGCATGGGTGGGATACGCTCTCGCGTGTACAGCAGATT
GGAGTGAAATTCTACGAGGAGTTCCAGGAAGGTATTCCCCGTGCTGAGAGCGAGGGTATTGCTACTGTGATTCAG
GATCATGCTGCTCGGGTTCGGGCGGAAGATGCAAATGGAATTGAGTGTGTGATTGTTGGCGGATACCGGCGTGGG
AAGCAAGTTAGTGGTGATGTTGATGTTATCTTGAGTCATCGTGATGATGCGGTGACTCGGAATCTGATTGTTGAT
CTTGTTGCGAGTCTTGAAGCTGAACGATATATCACTCATACGCTCTCGTTGCATTTGACTTCTTCGCTGCGCGAG
CAACAGACGTTGCCTTTTCATGGTGATGATACAAGGAAATTCGATACTTTGGACAAGGCACTGGTTGTCTGGCAA
GACCCACACTTCGATGCTACAGCTGTTGAACATAATGACCGTCAGGTGAAAAATCCAAACATCCATCGTCGTGTC
GATATCATTATATCGCCTTGGCGCACGGTCGGTTGCGCGATACTCGGCTGGTCTGGTGATCTGACTTTTCAGCGA
GATCTACGGCGGTATGCGAAGAAAGCACGCTTCTTGAAGTTCGATTCGAGTGGTGTGAGAGACCGAGGTACTGGA
AGACAAGTTGACCTCGAAGAAGATGGAGAGACATGGGAGGAGAGGGAGAAACTTGTGATGGAGGGACTGGGAATA
GGCTGGAGACCACCAGAAGAACGCTGCTCGAGATAG
Transcript >Pro_DTO377G3_2|g4249.t1
ATGATCGCAGATAAGAGCTCTTCTTCAAAAGACAAGACAGAACATGTCTCCCTCTTCTCAACCCAACCTCCCATC
TTCATTTTGCCAATGCATCTCTCCCTAGAGGAGCTGGACGAGATTGAAGGCCGATTGATAGATTATGGCGGAAGA
CTTACCTATGATATTGCCGAAGCTGGTCTCGTTTTGGGAAAAGTCGGGCGCGTGAAGCGTGCAGCGCTGGAACTG
CGCACCCGCGGTGTCTGGACAGAGGAGCTCATACCCAGCTCAACTCCAAAATCAATTGGCGGTGGCGGCGAGCCC
CCTCTCAAGCGCAGGCGCACAGATCAGTACGACGGAATCAATGATGTCCCGGTTGAGATTATCGATCTCAGTACC
GAGTCTGAAGGCGAGGATGGAGCTACGAATCAACATGATCCATCAAAGCAGCAGATCGCAGAGAAAAAGGCAGAA
GCAATTGAAAATTCAATCACAGTACTGAAGCTCGAGTGGCTGGATACCTCTATCACATCCGGCAGATGTGTTTCC
CAAGACCCATTCGTTGTCTACCGTGGGCGAAAGATCCCTTCTCCCCCAACGACAGTGTCAGAAAATAAGCAAGAC
TTACTTAAACAGAAATCAAATCAAATAATCCAGCGTGCAAAGGAAGATGCTGGTGTACCAACGCCACGAGCTCCT
CCTCCGGACCACATTCATGCACGGCGCTCAAAAGAACCCCCTGACAGATCTTCCCAGCACCCCCGACCGACGCTA
TACCGAAAGACAACCTCGGAACATGAAATGGATGAATCTAACGCACCCTCACAACCAGACTGGGTCCGTGACCAA
GTCATATTCGCATGCCTGCGCTCAGCACCCTTACACCCTCCAAACGAAGATTTTATCTTGCAACTCGTGAAAATA
AGACGTATTCGCGAACTCACCATCGACAAGATCGGCGTGCGCGCATATAGTACCGCCATCGCAGCATTGGCAGCA
TACCCATATCCCATCCAACGGCCGAGCGAGATCCTCGCTTTACCCGGGTGCAACGCCAAGATTGCGGACTTGTTC
GCGCAGTTCCAACAACATGGTGGCTGCGAGCATACCGACGACGACGGGAACGTTGCCGCTGCCGACTCGCTGGAG
AAAGATCCTATTCTCCGGGTTCTGAACTCGTTCTTTCAGATATGGGGTGTTGGGGCTAAGACAGCACGCGAGTTT
TACCAGCGTGGGTGGCGCGACCTCGATGATATTGTCGAGCATGGGTGGGATACGCTCTCGCGTGTACAGCAGATT
GGAGTGAAATTCTACGAGGAGTTCCAGGAAGGTATTCCCCGTGCTGAGAGCGAGGGTATTGCTACTGTGATTCAG
GATCATGCTGCTCGGGTTCGGGCGGAAGATGCAAATGGAATTGAGTGTGTGATTGTTGGCGGATACCGGCGTGGG
AAGCAAGTTAGTGGTGATGTTGATGTTATCTTGAGTCATCGTGATGATGCGGTGACTCGGAATCTGATTGTTGAT
CTTGTTGCGAGTCTTGAAGCTGAACGATATATCACTCATACGCTCTCGTTGCATTTGACTTCTTCGCTGCGCGAG
CAACAGACGTTGCCTTTTCATGGTGATGATACAAGGAAATTCGATACTTTGGACAAGGCACTGGTTGTCTGGCAA
GACCCACACTTCGATGCTACAGCTGTTGAACATAATGACCGTCAGGTGAAAAATCCAAACATCCATCGTCGTGTC
GATATCATTATATCGCCTTGGCGCACGGTCGGTTGCGCGATACTCGGCTGGTCTGGTGATCTGACTTTTCAGCGA
GATCTACGGCGGTATGCGAAGAAAGCACGCTTCTTGAAGTTCGATTCGAGTGGTGTGAGAGACCGAGGTACTGGA
AGACAAGTTGACCTCGAAGAAGATGGAGAGACATGGGAGGAGAGGGAGAAACTTGTGATGGAGGGACTGGGAATA
GGCTGGAGACCACCAGAAGAACGCTGCTCGAGATAG
Gene >Pro_DTO377G3_2|g4249.t1
ATGATCGCAGATAAGAGCTCTTCTTCAAAAGACAAGACAGAACATGTCTCCCTCTTCTCAACCCAACCTCCCATC
TTCATTTTGCCAATGCATCTCTCCCTAGAGGAGCTGGACGAGATTGAAGGCCGATTGATAGATTATGGCGGAAGA
CTTACCTATGATATTGCCGAAGCTGGTCTCGTTTTGGGAAAAGTCGGGCGCGTGAAGCGTGCAGCGCTGGAACTG
CGCACCCGCGGTGTCTGGACAGAGGAGCTCATACCCAGCTCAACTCCAAAATCAATTGGCGGTGGCGGCGAGCCC
CCTCTCAAGCGCAGGCGCACAGATCAGTACGACGGAATCAATGATGTCCCGGTTGAGATTATCGATCTCAGTACC
GAGTCTGAAGGCGAGGATGGAGCTACGAATCAACATGATCCATCAAAGCAGCAGATCGCAGAGAAAAAGGCAGAA
GCAATTGAAAATTCAATCACAGTACTGAAGCTCGAGTGGCTGGATACCTCTATCACATCCGGCAGATGTGTTTCC
CAAGACCCATTCGTTGTCTACCGTGGGCGAAAGATCCCTTCTCCCCCAACGACAGTGTCAGAAAATAAGCAAGAC
TTACTTAAACAGAAATCAAATCAAATAATCCAGCGTGCAAAGGAAGATGCTGGTGTACCAACGCCACGAGCTCCT
CCTCCGGACCACATTCATGCACGGCGCTCAAAAGAACCCCCTGACAGATCTTCCCAGCACCCCCGACCGACGCTA
TACCGAAAGACAACCTCGGAACATGAAATGGATGAATCTAACGCACCCTCACAACCAGACTGGGTCCGTGACCAA
GTCATATTCGCATGCCTGCGCTCAGCACCCTTACACCCTCCAAACGAAGATTTTATCTTGCAACTCGTGAAAATA
AGACGTATTCGCGAACTCACCATCGACAAGATCGGCGTGCGCGCATATAGTACCGCCATCGCAGCATTGGCAGCA
TACCCATATCCCATCCAACGGCCGAGCGAGATCCTCGCTTTACCCGGGTGCAACGCCAAGATTGCGGACTTGTTC
GCGCAGTTCCAACAACATGGTGGCTGCGAGCATACCGACGACGACGGGAACGTTGCCGCTGCCGACTCGCTGGAG
AAAGATCCTATTCTCCGGGTTCTGAACTCGTTCTTTCAGATATGGGGTGTTGGGGCTAAGACAGCACGCGAGTTT
TACCAGCGTGGGTGGCGCGACCTCGATGATATTGTCGAGCATGGGTGGGATACGCTCTCGCGTGTACAGCAGATT
GGAGTGAAATTCTACGAGGAGTTCCAGGAAGGTATTCCCCGTGCTGAGAGCGAGGGTATTGCTACTGTGATTCAG
GATCATGCTGCTCGGGTTCGGGCGGAAGATGCAAATGGAATTGAGTGTGTGATTGTTGGCGGATACCGGCGTGGG
AAGCAAGTTAGTGGTGATGTTGATGTTATCTTGAGTCATCGTGATGATGCGGTGACTCGGAATCTGATTGTTGAT
CTTGTTGCGAGTCTTGAAGCTGAACGATATATCACTCATACGCTCTCGTTGCATTTGACTTCTTCGCTGCGCGAG
CAACAGACGTTGCCTTTTCATGGTGATGATACAAGGAAATTCGATACTTTGGACAAGGCACTGGTTGTCTGGCAA
GACCCACACTTCGATGCTACAGCTGTTGAACATAATGACCGTCAGGTGAAAAATCCAAACATCCATCGTCGTGTC
GATATCATTATATCGCCTTGGCGCACGGTCGGTTGCGCGATACTCGGCTGGTCTGGTGATCTGACTTTTCAGCGA
GATCTACGGCGGTATGCGAAGAAAGCACGCTTCTTGAAGTTCGATTCGAGTGGTGTGAGAGACCGAGGTACTGGA
AGACAAGTTGACCTCGAAGAAGATGGAGAGACATGGGAGGAGAGGGAGAAACTTGTGATGGAGGGACTGGGAATA
GGCTGGAGACCACCAGAAGAACGCTGCTCGAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail