Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4240.t1
Gene name
Locationscaffold_08:441622..443221
Strand-
Gene length (bp)1599
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 1.6E-15 295 465

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0030001 metal ion transport Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0008324 cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 49 71 22
3 86 108 22
4 378 400 22
5 410 432 22
6 445 467 22
7 477 499 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 174.97 105.41 244.53
5d_25C Five days - 25 degrees Celsius 250.98 148.84 353.13
7d_25C Seven days - 25 degrees Celsius 255.29 150.18 360.40
10d_25C Ten days - 25 degrees Celsius 327.48 189.97 464.98
7d_15C Seven days - 15 degrees Celsius 211.68 124.14 299.21
7d_30C Seven days - 30 degrees Celsius 235.68 139.38 331.98

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.100869 no
3d_25C 7d_25C 0.091337 no
3d_25C 7d_15C 0.471100 no
3d_25C 7d_30C 0.200959 no
3d_25C 10d_25C 0.001804 yes
5d_25C 7d_25C 0.963305 no
5d_25C 7d_15C 0.530561 no
5d_25C 7d_30C 0.843414 no
5d_25C 10d_25C 0.277165 no
7d_25C 7d_15C 0.487426 no
7d_25C 7d_30C 0.799478 no
7d_25C 10d_25C 0.324525 no
7d_15C 7d_30C 0.721922 no
7d_15C 10d_25C 0.051659 no
7d_30C 10d_25C 0.161860 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4240.t1
MSANDLRGWVMSTVSGVACVLGSSIICVDVLVQVVSRRKSFQIANSSHFLSASLCLSAGVMLFTSLYSMLPTSKQ
YLTRAGFSPAVSAYMLIGLFIAGVAGIQILSAFAHRYIPSHVVDCAHTHDESENDAERGEAAHEDHVHNDTNGHT
ERTPLLQHNKPSSFKSTPAVVQASQHIEPAPRRRDTMRAMLARRITSFMGGVKSACDEDGPCFGVSQTCGLECNK
VLPPPNSDESARPNLLHCEGISVPLESEISRVGIDDIEHVPPTPEGRDFDNISVQHDMHRSSTSSPILDPHLSHR
SRPHSEHHHHDESHSYLDDIDSGRPKSAGGNPHHHHVPKNAFLSIGLQTSLAIALHKLPEGFITYATNHASPTLG
MTVFLALVIHNIVEGFAMSLPLYLALNSRWRAMFWSSLLGGISQPAGAGLAALWIWSTGQRGSDDATGPSWGIYG
GMFAVTAGVMTSVALQLFSEGLGLTHHRGMGIGFAVGGMGLMGLSFALTA*
Coding >Pro_DTO377G3_2|g4240.t1
ATGTCTGCCAACGACCTTCGGGGATGGGTGATGAGCACCGTCTCAGGCGTCGCATGCGTCCTTGGTTCCTCTATC
ATCTGCGTCGATGTGCTGGTTCAAGTGGTCTCCCGCCGCAAGAGCTTCCAGATCGCCAACAGTAGTCATTTCCTG
TCGGCATCATTATGTCTCAGTGCTGGAGTCATGCTCTTTACCTCCCTCTACAGCATGCTTCCCACATCCAAGCAG
TACCTTACCCGCGCCGGCTTCTCTCCCGCTGTATCTGCATATATGTTGATCGGTCTTTTCATTGCTGGAGTGGCC
GGCATTCAAATACTATCCGCGTTCGCACATCGTTACATCCCATCTCATGTTGTCGACTGTGCCCATACCCATGAC
GAGTCAGAAAATGATGCCGAGCGCGGCGAGGCCGCACACGAGGACCATGTCCACAACGATACAAATGGACATACC
GAACGAACACCGCTGTTGCAACATAATAAGCCATCTTCATTCAAGTCAACGCCAGCGGTAGTACAAGCGAGCCAA
CACATCGAGCCGGCACCCAGACGCCGCGACACGATGCGGGCAATGCTAGCGCGCCGCATTACGTCGTTCATGGGT
GGCGTAAAATCCGCCTGTGACGAGGACGGGCCTTGCTTCGGGGTTTCTCAAACCTGTGGCCTCGAATGCAACAAA
GTGCTTCCACCACCCAACAGCGATGAGAGCGCGCGACCAAACTTGCTGCATTGTGAAGGTATATCCGTGCCGCTG
GAATCGGAAATTTCCCGCGTAGGAATTGACGACATTGAACATGTGCCTCCCACTCCGGAAGGGAGAGATTTTGAC
AACATCTCTGTACAGCATGACATGCACCGATCGTCCACTTCGTCTCCCATTTTAGACCCACATTTAAGTCATCGA
TCTCGTCCGCATTCTGAGCATCATCACCATGACGAATCTCATAGCTACCTGGACGATATTGATTCTGGGCGTCCC
AAATCTGCCGGCGGCAACCCCCACCACCATCACGTTCCTAAAAATGCATTCCTTTCCATTGGGCTTCAAACCTCA
CTCGCCATTGCTCTACATAAGCTTCCAGAGGGGTTCATTACTTACGCCACAAACCACGCCAGCCCAACCCTCGGT
ATGACAGTATTTCTGGCTCTAGTTATCCACAACATTGTGGAGGGCTTCGCCATGTCACTTCCGCTCTATCTAGCC
CTCAATTCCCGCTGGAGAGCAATGTTCTGGTCTAGTCTCCTAGGAGGTATCAGTCAACCAGCCGGTGCTGGACTC
GCAGCGCTCTGGATCTGGAGCACTGGGCAACGCGGTAGCGACGATGCCACTGGTCCCTCGTGGGGTATATATGGA
GGTATGTTTGCCGTCACCGCCGGAGTCATGACTTCGGTTGCGTTGCAACTTTTCAGCGAGGGACTTGGGCTCACC
CATCACCGCGGAATGGGTATCGGGTTCGCTGTGGGAGGCATGGGGTTGATGGGCCTCAGCTTTGCATTGACCGCT
TGA
Transcript >Pro_DTO377G3_2|g4240.t1
ATGTCTGCCAACGACCTTCGGGGATGGGTGATGAGCACCGTCTCAGGCGTCGCATGCGTCCTTGGTTCCTCTATC
ATCTGCGTCGATGTGCTGGTTCAAGTGGTCTCCCGCCGCAAGAGCTTCCAGATCGCCAACAGTAGTCATTTCCTG
TCGGCATCATTATGTCTCAGTGCTGGAGTCATGCTCTTTACCTCCCTCTACAGCATGCTTCCCACATCCAAGCAG
TACCTTACCCGCGCCGGCTTCTCTCCCGCTGTATCTGCATATATGTTGATCGGTCTTTTCATTGCTGGAGTGGCC
GGCATTCAAATACTATCCGCGTTCGCACATCGTTACATCCCATCTCATGTTGTCGACTGTGCCCATACCCATGAC
GAGTCAGAAAATGATGCCGAGCGCGGCGAGGCCGCACACGAGGACCATGTCCACAACGATACAAATGGACATACC
GAACGAACACCGCTGTTGCAACATAATAAGCCATCTTCATTCAAGTCAACGCCAGCGGTAGTACAAGCGAGCCAA
CACATCGAGCCGGCACCCAGACGCCGCGACACGATGCGGGCAATGCTAGCGCGCCGCATTACGTCGTTCATGGGT
GGCGTAAAATCCGCCTGTGACGAGGACGGGCCTTGCTTCGGGGTTTCTCAAACCTGTGGCCTCGAATGCAACAAA
GTGCTTCCACCACCCAACAGCGATGAGAGCGCGCGACCAAACTTGCTGCATTGTGAAGGTATATCCGTGCCGCTG
GAATCGGAAATTTCCCGCGTAGGAATTGACGACATTGAACATGTGCCTCCCACTCCGGAAGGGAGAGATTTTGAC
AACATCTCTGTACAGCATGACATGCACCGATCGTCCACTTCGTCTCCCATTTTAGACCCACATTTAAGTCATCGA
TCTCGTCCGCATTCTGAGCATCATCACCATGACGAATCTCATAGCTACCTGGACGATATTGATTCTGGGCGTCCC
AAATCTGCCGGCGGCAACCCCCACCACCATCACGTTCCTAAAAATGCATTCCTTTCCATTGGGCTTCAAACCTCA
CTCGCCATTGCTCTACATAAGCTTCCAGAGGGGTTCATTACTTACGCCACAAACCACGCCAGCCCAACCCTCGGT
ATGACAGTATTTCTGGCTCTAGTTATCCACAACATTGTGGAGGGCTTCGCCATGTCACTTCCGCTCTATCTAGCC
CTCAATTCCCGCTGGAGAGCAATGTTCTGGTCTAGTCTCCTAGGAGGTATCAGTCAACCAGCCGGTGCTGGACTC
GCAGCGCTCTGGATCTGGAGCACTGGGCAACGCGGTAGCGACGATGCCACTGGTCCCTCGTGGGGTATATATGGA
GGTATGTTTGCCGTCACCGCCGGAGTCATGACTTCGGTTGCGTTGCAACTTTTCAGCGAGGGACTTGGGCTCACC
CATCACCGCGGAATGGGTATCGGGTTCGCTGTGGGAGGCATGGGGTTGATGGGCCTCAGCTTTGCATTGACCGCT
TGA
Gene >Pro_DTO377G3_2|g4240.t1
ATGTCTGCCAACGACCTTCGGGGATGGGTGATGAGCACCGTCTCAGGCGTCGGTGAGCGTCGCCTGGAGTCTTTG
AAATATTAGCCACTAACTATCTTCAGCATGCGTCCTTGGTTCCTCTATCATCTGCGTCGATGTGCTGGTTCAAGT
GGTCTCCCGCCGCAAGAGCTTCCAGATCGCCAACAGTAGTCATTTCCTGTCGGCATCATTATGTCTCAGTGCTGG
AGTCATGGTAGGCATTATTCTGGAGGAATAGTGAACTATGTTAATCCTAGGCAGCTCTTTACCTCCCTCTACAGC
ATGCTTCCCACATCCAAGCAGTACCTTACCCGCGCCGGCTTCTCTCCCGCTGTATCTGCATATATGTTGATCGGT
CTTTTCATTGCTGGAGTGGCCGGCATTCAAATACTATCCGCGTTCGCACATCGTTACATCCCATCTCATGTTGTC
GACTGTGCCCATACCCATGACGAGTCAGAAAATGATGCCGAGCGCGGCGAGGCCGCACACGAGGACCATGTCCAC
AACGATACAAATGGACATACCGAACGAACACCGCTGTTGCAACATAATAAGCCATCTTCATTCAAGTCAACGCCA
GCGGTAGTACAAGCGAGCCAACACATCGAGCCGGCACCCAGACGCCGCGACACGATGCGGGCAATGCTAGCGCGC
CGCATTACGTCGTTCATGGGTGGCGTAAAATCCGCCTGTGACGAGGACGGGCCTTGCTTCGGGGTTTCTCAAACC
TGTGGCCTCGAATGCAACAAAGTGCTTCCACCACCCAACAGCGATGAGAGCGCGCGACCAAACTTGCTGCATTGT
GAAGGTATATCCGTGCCGCTGGAATCGGAAATTTCCCGCGTAGGAATTGACGACATTGAACATGTGCCTCCCACT
CCGGAAGGGAGAGATTTTGACAACATCTCTGTACAGCATGACATGCACCGATCGTCCACTTCGTCTCCCATTTTA
GACCCACATTTAAGTCATCGATCTCGTCCGCATTCTGAGCATCATCACCATGACGAATCTCATAGCTACCTGGAC
GATATTGATTCTGGGCGTCCCAAATCTGCCGGCGGCAACCCCCACCACCATCACGTTCCTAAAAATGCATTCCTT
TCCATTGGGCTTCAAACCTCACTCGCCATTGCTCTACATAAGCTTCCAGAGGGGTTCATTACTTACGCCACAAAC
CACGCCAGCCCAACCCTCGGTATGACAGTATTTCTGGCTCTAGTTATCCACAACATTGTGGAGGGCTTCGCCATG
TCACTTCCGCTCTATCTAGCCCTCAATTCCCGCTGGAGAGCAATGTTCTGGTCTAGTCTCCTAGGAGGTATCAGT
CAACCAGCCGGTGCTGGACTCGCAGCGCTCTGGATCTGGAGCACTGGGCAACGCGGTAGCGACGATGCCACTGGT
CCCTCGTGGGGTATATATGGAGGTATGTTTGCCGTCACCGCCGGAGTCATGACTTCGGTTGCGTTGCAACTTTTC
AGCGAGGGACTTGGGCTCACCCATCACCGCGGAATGGGTATCGGGTTCGCTGTGGGAGGCATGGGGTTGATGGGC
CTCAGCTTTGCATTGACCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail