Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4231.t1
Gene name
Locationscaffold_08:409192..411232
Strand+
Gene length (bp)2040
Transcript length (bp)1860
Coding sequence length (bp)1860
Protein length (aa) 620

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 7.6E-67 15 325
PF05199 GMC_oxred_C GMC oxidoreductase 1.2E-29 471 604
PF05834 Lycopene_cycl Lycopene cyclase protein 7.2E-06 15 50
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 9.4E-05 18 48

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 3.55 1.14 5.95
5d_25C Five days - 25 degrees Celsius 2.35 0.63 4.08
7d_25C Seven days - 25 degrees Celsius 3.56 1.15 5.96
10d_25C Ten days - 25 degrees Celsius 2.32 0.48 4.15
7d_15C Seven days - 15 degrees Celsius 3.47 1.12 5.82
7d_30C Seven days - 30 degrees Celsius 3.96 1.32 6.59

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.347339 no
3d_25C 7d_25C 0.997455 no
3d_25C 7d_15C 0.972323 no
3d_25C 7d_30C 0.842113 no
3d_25C 10d_25C 0.352683 no
5d_25C 7d_25C 0.340824 no
5d_25C 7d_15C 0.382605 no
5d_25C 7d_30C 0.210485 no
5d_25C 10d_25C 0.981280 no
7d_25C 7d_15C 0.967799 no
7d_25C 7d_30C 0.844583 no
7d_25C 10d_25C 0.350686 no
7d_15C 7d_30C 0.804272 no
7d_15C 10d_25C 0.382087 no
7d_30C 10d_25C 0.217893 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4231.t1
MGNETLQQFAALDLDYLIIGGGTAGLAVAARLTEDTGFHVGVIEAGPSVLNIDDNGAINVPGRYGETIGSKYDWK
FETTPQPGLGGRSLPWPRGRILGGTSALNLMAWNRGHRKDYDSWAELGNEGWGWEDLLPFFRRSENFHPPSAAHQ
KYYQSSYDPQANGTKGPLHTTHAKQYGPTHQYWHETLNNLGVPSTPDSLAGDNTGVWNMVCTIDPDSQERSYSAS
AYYHPISNRPNLHILTEATAMEILFNCDNDDWYAAGARVRWNGLEANIKAYEETIVCAGSVQSPQLLELSGIGDQ
EVLRAAGIEMKVHSPNVGENLQEHMMTATIFEISSTIPTRDDILKDPIQREAADRAYYASQAGPWTVMPCSVAYC
PLSKILSPKECDELHTQAKEIARETGRTHDAILAGQFEYGHARGQIEYLFDLGNWSPYFVSEPGKKYATMLQMLQ
YPFSRGSIHIPAMGEHNYEKATIDDKPVIDPRYFLGPGEIDKKVMAKALRWGDRICQTKPLAKLIRRRVFPPPAK
EADSEEKVYEEFVSNYTVTDWHPVGTCAMGEADGTNAGVVNDMLQVHGVYCLRVVDASIMPLQVGAHIQATVYAI
AEKAAEMIIDDYFARNGPR*
Coding >Pro_DTO377G3_2|g4231.t1
ATGGGTAATGAGACCCTTCAGCAGTTTGCTGCCCTCGACCTCGACTACTTGATTATAGGCGGAGGTACCGCAGGT
CTAGCTGTTGCTGCACGCCTCACCGAGGACACTGGATTCCACGTGGGAGTCATCGAAGCCGGCCCATCGGTCTTG
AACATAGATGATAATGGCGCGATCAATGTTCCTGGTCGGTATGGCGAAACCATCGGCTCTAAATACGATTGGAAA
TTCGAAACTACCCCACAGCCGGGCCTAGGAGGAAGATCACTACCATGGCCACGAGGCCGTATATTAGGCGGCACA
AGTGCGCTCAATCTTATGGCCTGGAACCGGGGTCATCGCAAAGACTATGATTCCTGGGCGGAACTTGGGAATGAG
GGATGGGGATGGGAAGATCTACTGCCTTTTTTCCGCCGCAGCGAGAATTTCCACCCACCGAGTGCCGCTCATCAG
AAATATTATCAGTCTTCCTATGATCCCCAGGCTAATGGAACGAAGGGCCCTCTTCATACAACTCATGCCAAGCAG
TATGGTCCCACACACCAATATTGGCATGAGACGCTCAATAATCTCGGGGTTCCATCCACGCCCGATAGCCTGGCT
GGCGATAATACAGGTGTCTGGAACATGGTGTGCACAATTGATCCAGATAGTCAGGAGCGCAGCTACTCTGCCTCT
GCATACTACCACCCCATCTCAAATCGCCCAAACCTACACATACTGACTGAAGCAACTGCCATGGAGATCCTGTTT
AATTGCGACAATGATGATTGGTACGCAGCAGGGGCCCGAGTACGCTGGAATGGACTGGAAGCAAACATCAAAGCA
TACGAAGAGACAATCGTCTGTGCCGGTAGCGTGCAATCGCCGCAACTTCTAGAGCTATCTGGTATTGGCGATCAG
GAAGTGTTAAGAGCTGCTGGAATTGAGATGAAAGTCCACAGTCCCAACGTAGGGGAGAATCTACAGGAGCATATG
ATGACGGCTACCATCTTCGAAATATCCTCGACGATTCCAACCCGAGATGACATCCTCAAAGACCCCATTCAGCGC
GAAGCTGCGGACCGCGCGTATTACGCTTCTCAAGCTGGGCCTTGGACTGTGATGCCCTGTTCAGTGGCGTACTGT
CCGCTTTCGAAGATCCTATCGCCCAAGGAATGTGATGAATTACACACCCAGGCCAAGGAAATCGCGCGAGAGACA
GGAAGGACACATGACGCTATTCTGGCTGGCCAATTCGAGTACGGTCATGCGCGCGGTCAAATCGAATATCTGTTC
GACCTTGGTAACTGGAGCCCATATTTTGTCTCTGAGCCAGGAAAGAAATACGCCACAATGCTGCAAATGCTGCAG
TACCCTTTCTCGCGCGGATCTATCCATATCCCTGCTATGGGCGAACACAATTATGAAAAGGCCACAATTGATGAT
AAACCCGTGATTGATCCGCGATATTTTCTGGGGCCTGGGGAGATTGATAAGAAGGTCATGGCCAAAGCACTCAGG
TGGGGAGATCGAATCTGCCAAACCAAGCCCTTGGCCAAACTCATTCGTCGTCGAGTCTTTCCTCCCCCTGCCAAG
GAAGCAGACTCTGAAGAGAAAGTATACGAAGAGTTTGTCTCAAATTATACTGTCACTGACTGGCATCCGGTTGGG
ACCTGCGCTATGGGTGAAGCAGATGGGACCAATGCTGGAGTTGTGAATGATATGCTACAGGTGCATGGCGTCTAT
TGTCTGCGGGTTGTAGATGCTAGCATCATGCCATTGCAGGTTGGGGCACACATCCAAGCCACCGTATACGCGATT
GCCGAAAAGGCGGCGGAGATGATCATAGATGACTATTTTGCTCGAAACGGTCCCCGATGA
Transcript >Pro_DTO377G3_2|g4231.t1
ATGGGTAATGAGACCCTTCAGCAGTTTGCTGCCCTCGACCTCGACTACTTGATTATAGGCGGAGGTACCGCAGGT
CTAGCTGTTGCTGCACGCCTCACCGAGGACACTGGATTCCACGTGGGAGTCATCGAAGCCGGCCCATCGGTCTTG
AACATAGATGATAATGGCGCGATCAATGTTCCTGGTCGGTATGGCGAAACCATCGGCTCTAAATACGATTGGAAA
TTCGAAACTACCCCACAGCCGGGCCTAGGAGGAAGATCACTACCATGGCCACGAGGCCGTATATTAGGCGGCACA
AGTGCGCTCAATCTTATGGCCTGGAACCGGGGTCATCGCAAAGACTATGATTCCTGGGCGGAACTTGGGAATGAG
GGATGGGGATGGGAAGATCTACTGCCTTTTTTCCGCCGCAGCGAGAATTTCCACCCACCGAGTGCCGCTCATCAG
AAATATTATCAGTCTTCCTATGATCCCCAGGCTAATGGAACGAAGGGCCCTCTTCATACAACTCATGCCAAGCAG
TATGGTCCCACACACCAATATTGGCATGAGACGCTCAATAATCTCGGGGTTCCATCCACGCCCGATAGCCTGGCT
GGCGATAATACAGGTGTCTGGAACATGGTGTGCACAATTGATCCAGATAGTCAGGAGCGCAGCTACTCTGCCTCT
GCATACTACCACCCCATCTCAAATCGCCCAAACCTACACATACTGACTGAAGCAACTGCCATGGAGATCCTGTTT
AATTGCGACAATGATGATTGGTACGCAGCAGGGGCCCGAGTACGCTGGAATGGACTGGAAGCAAACATCAAAGCA
TACGAAGAGACAATCGTCTGTGCCGGTAGCGTGCAATCGCCGCAACTTCTAGAGCTATCTGGTATTGGCGATCAG
GAAGTGTTAAGAGCTGCTGGAATTGAGATGAAAGTCCACAGTCCCAACGTAGGGGAGAATCTACAGGAGCATATG
ATGACGGCTACCATCTTCGAAATATCCTCGACGATTCCAACCCGAGATGACATCCTCAAAGACCCCATTCAGCGC
GAAGCTGCGGACCGCGCGTATTACGCTTCTCAAGCTGGGCCTTGGACTGTGATGCCCTGTTCAGTGGCGTACTGT
CCGCTTTCGAAGATCCTATCGCCCAAGGAATGTGATGAATTACACACCCAGGCCAAGGAAATCGCGCGAGAGACA
GGAAGGACACATGACGCTATTCTGGCTGGCCAATTCGAGTACGGTCATGCGCGCGGTCAAATCGAATATCTGTTC
GACCTTGGTAACTGGAGCCCATATTTTGTCTCTGAGCCAGGAAAGAAATACGCCACAATGCTGCAAATGCTGCAG
TACCCTTTCTCGCGCGGATCTATCCATATCCCTGCTATGGGCGAACACAATTATGAAAAGGCCACAATTGATGAT
AAACCCGTGATTGATCCGCGATATTTTCTGGGGCCTGGGGAGATTGATAAGAAGGTCATGGCCAAAGCACTCAGG
TGGGGAGATCGAATCTGCCAAACCAAGCCCTTGGCCAAACTCATTCGTCGTCGAGTCTTTCCTCCCCCTGCCAAG
GAAGCAGACTCTGAAGAGAAAGTATACGAAGAGTTTGTCTCAAATTATACTGTCACTGACTGGCATCCGGTTGGG
ACCTGCGCTATGGGTGAAGCAGATGGGACCAATGCTGGAGTTGTGAATGATATGCTACAGGTGCATGGCGTCTAT
TGTCTGCGGGTTGTAGATGCTAGCATCATGCCATTGCAGGTTGGGGCACACATCCAAGCCACCGTATACGCGATT
GCCGAAAAGGCGGCGGAGATGATCATAGATGACTATTTTGCTCGAAACGGTCCCCGATGA
Gene >Pro_DTO377G3_2|g4231.t1
ATGGGTAATGAGACCCTTCAGCAGTTTGCTGCCCTCGACCTCGACTACTTGATTATAGGCGGAGGTACCGCAGGT
CTAGCTGTTGCTGCACGCCTCACCGAGGACACTGGATTCCACGTGGGAGTCATCGAAGCCGGCCCATCGGTCTTG
AACATAGATGATAATGGCGCGATCAATGTTCCTGGTCGGTATGGCGAAACCATCGGCTCTAAATACGATTGGAAA
TTCGAAACTACCCCACAGCCGGGCCTAGGAGGAAGATCACTACCATGGCCACGAGGCCGTATATTAGGCGGCACA
AGTGCGCTCAATCTTATGGCCTGGAACCGGGGTCATCGCAAAGACTATGATTCCTGGGCGGAACTTGGGAATGAG
GGATGGGGATGGGAAGATCTACTGTATGAGGACCAGCTTTCTGGGATTCGCGCTCTGTCTTGGATCTCACCCGCT
GATCTGTGAGATGCTGAATTCCTTCCAGGCCTTTTTTCCGCCGCAGCGAGAATTTCCACCCACCGAGTGCCGCTC
ATCAGAAATATTATCAGTCTTCCTATGATCCCCAGGCTAATGGAACGAAGGGCCCTCTTCATACAACTCATGCCA
AGCAGTATGGTCCCACACACCAATATTGGCATGAGACGCTCAATAATCTCGGGGTTCCATCCACGCCCGATAGCC
TGGCTGGCGATAATACAGGTGTCTGGAACATGGTGTGCACAATTGATCCAGATAGTCAGGAGCGCAGCTACTCTG
CCTCTGCATACTACCACCCCATCTCAAATCGCCCAAACCTACACATACTGACTGAAGCAACTGCCATGGAGATCC
TGTTTAATTGCGACAATGATGATTGGTACGCAGCAGGGGCCCGAGTACGCTGGAATGGACTGGAAGCAAACATCA
AAGCATACGAAGAGACAATCGTCTGTGCCGGTAGCGTGCAATCGCCGCAACTTCTAGAGCTATCTGGTATTGGCG
ATCAGGAAGTGTTAAGAGCTGCTGGAATTGAGATGAAAGTCCACAGTCCCAACGTAGGGGAGAATCTACAGGAGC
ATATGAGTATGGAATATAAACAGTGTTCCTTGTGATCTGAGCTGACGTGTTCAAGTGACGGCTACCATCTTCGAA
ATATCCTCGACGATTCCAACCCGAGATGACATCCTCAAAGACCCCATTCAGCGCGAAGCTGCGGACCGCGCGTAT
TACGCTTCTCAAGCTGGGCCTTGGACTGTGATGCCCTGTTCAGTGGCGTACTGTCCGCTTTCGAAGATCCTATCG
CCCAAGGAATGTGATGAATTACACACCCAGGCCAAGGAAATCGCGCGAGAGACAGGAAGGACACATGACGCTATT
CTGGCTGGCCAATTCGAGTACGGTCATGCGCGCGGTCAAATCGAATATCTGTTCGACCTTGGTAACTGGAGCCCA
TATTTTGTCTCTGAGCCAGGAAAGAAATACGCCACAATGCTGCAAATGCTGCAGTACCCTTTCTCGCGCGGATCT
ATCCATATCCCTGCTATGGGCGAACACAATTATGAAAAGGCCACAATTGATGATAAACCCGTGATTGATCCGCGA
TATTTTCTGGGGCCTGGGGAGATTGATAAGAAGGTCATGGCCAAAGCACTCAGGTGGGGAGATCGAATCTGCCAA
ACCAAGCCCTTGGCCAAACTCATTCGTCGTCGAGTCTTTCCTCCCCCTGCCAAGGAAGCAGACTCTGAAGAGAAA
GTATACGAAGAGTTTGTCTCAAATTATACTGTCACTGACTGGCATCGTATGTTTCCCCTCCAAGATTCATCCAGC
AAATCACTAAATATGCGTATAGCGGTTGGGACCTGCGCTATGGGTGAAGCAGATGGGACCAATGCTGGAGTTGTG
AATGATATGCTACAGGTGCATGGCGTCTATTGTCTGCGGGTTGTAGATGCTAGCATCATGCCATTGCAGGTTGGG
GCACACATCCAAGCCACCGTATACGCGATTGCCGAAAAGGCGGCGGAGATGATCATAGATGACTATTTTGCTCGA
AACGGTCCCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail