Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4226.t1
Gene name
Locationscaffold_08:388893..392890
Strand-
Gene length (bp)3997
Transcript length (bp)3798
Coding sequence length (bp)3798
Protein length (aa) 1266

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 28 47 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 104.46 61.52 147.41
5d_25C Five days - 25 degrees Celsius 202.59 110.82 294.36
7d_25C Seven days - 25 degrees Celsius 240.56 128.54 352.57
10d_25C Ten days - 25 degrees Celsius 380.25 196.15 564.35
7d_15C Seven days - 15 degrees Celsius 176.70 94.44 258.97
7d_30C Seven days - 30 degrees Celsius 184.64 101.31 267.96

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.003625 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.024170 yes
3d_25C 7d_30C 0.010083 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.579278 no
5d_25C 7d_15C 0.677799 no
5d_25C 7d_30C 0.785901 no
5d_25C 10d_25C 0.007437 yes
7d_25C 7d_15C 0.261171 no
7d_25C 7d_30C 0.345319 no
7d_25C 10d_25C 0.066129 no
7d_15C 7d_30C 0.908982 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.003197 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4226.t1
MVVKGNEVTDVTTKAKGRMDLEKPRRKGFVRWTIGLIVRLCIWYALLTPFFRCPTHLEDLTETSPRVCKPYLIAR
SHVEPYVTPYYDIYAAPYVDQARPYVKVFNQRVYTPASKFTKSGYEKYGAPTLKQAQAYGIEQWEHQVSPRLRTA
QNKVHQVYLAKIDPHVQQSVDVVSPYCQWASTVVLNVYQGQLVPFYARSKPFIGKVYSTGQGILATHVMPGAQYT
WSSAIYFANSSLWPHVTGLYSEQVEPQLVKIGQRLASYREGKRLRAVIEDVDSSSTVQPVSSLTTKSQEQIHTST
TMTSTFTPQASVQPTLTPTEQAQQVREEIDSDLWRWQERFSLAADKGIEDLEGRIGEIVSALVASSANTHGQSLS
TALQSVSAEQISSMKQRINELAGSMPEVDAPEIEKSTSDLLIREIRTSAISVRDRAHALREWSISFEDELVRRVT
AAVNSTIDVLDSIRNLGLQEIGMRWAWMDGVTYKDWAKYHALKAQLEEWRNDIRNVGMNHKSVSDARAVASDILD
QGMHEAEQAARELVRLKDVGIWKIAAREVSDHFETRTEAPPTRPKAQEETEESDEEAAKMVFGNDESSEEVATPI
SDDAYEETPFTDEPSAAVNAEADFDGVNESVMDDDIVVENQPSARPAFGVAAADANLHQAPILDDESHNVQDSLA
SKVGDTYAGASDAVSEAVYGASTTNGVGEKVASLASEQYSVAWSAASTVIHGTPLSPVEKVYSDGSEKYSDAVAA
ASSVIYGTPTPVVQSLMDGASSTFADSTHQAKVLYEIAKSQVLSRIAESSAPVHVQILASIESAYSGSLKYATDE
LESKLRSVRATPTPSNVGPLAHISSIASSRLSHGLSLASEQLARVQPPATTASIPQGGLEPFVLDAQRRYYEAVG
LAHDHYSVFVSTASEAVYGSPTPTPAGSSKGIIEEAGSQYEHVSSLVSASLAAVVASASSVMSSADGGKAQSIVE
DASSRYNAALSAASSSLSVASISASSVIHGTSTGPVESLYSQVPEKWESLISKASEQIYGAPTPFLQQVVNNGRP
QFEAVQGLVSELIAGKQPSYTESVLSKLRAAYETPYPAVAFSSASSYVNEAYGSASSVAASVISEAPSVEDIIQH
ANNQLRAAVETASVGIYGTPKGSYEKATDAAADAYSTASAQIISAVYGKESSYLDVAKDAIENIQSTASAAIYGK
EPSAVESAAIRLARAKKDAMSQLADLAANLPASNVIFEAVETATAHLKDTTSSIKSSAVSVKDEL*
Coding >Pro_DTO377G3_2|g4226.t1
ATGGTAGTGAAAGGGAATGAAGTGACGGATGTCACGACCAAAGCAAAGGGCCGAATGGATCTTGAAAAGCCACGG
AGAAAGGGCTTCGTCCGATGGACAATCGGACTTATCGTGAGGCTATGTATCTGGTACGCACTCTTGACGCCATTT
TTCAGGTGCCCAACCCATCTCGAAGACCTCACAGAGACATCACCTCGAGTCTGCAAGCCCTACCTGATTGCTCGT
TCACACGTGGAACCTTATGTGACGCCATATTATGATATTTATGCGGCGCCTTACGTTGATCAAGCCCGGCCTTAC
GTGAAAGTTTTTAATCAGCGAGTTTATACCCCTGCATCAAAATTTACCAAATCAGGATATGAGAAGTATGGAGCG
CCGACATTGAAGCAAGCTCAGGCATATGGGATTGAGCAATGGGAACATCAAGTCTCACCAAGACTACGGACTGCT
CAAAATAAGGTTCACCAGGTTTACTTAGCCAAGATTGATCCCCACGTCCAGCAAAGCGTTGATGTTGTCTCTCCA
TACTGCCAATGGGCCAGCACCGTTGTGCTCAATGTCTATCAGGGCCAACTGGTCCCTTTCTACGCGCGTTCAAAA
CCTTTCATCGGGAAAGTTTACTCCACCGGCCAGGGTATTTTGGCAACCCATGTCATGCCCGGGGCGCAGTATACC
TGGTCATCCGCGATCTACTTTGCTAACAGCTCACTATGGCCTCACGTTACTGGTCTTTACTCTGAACAAGTGGAG
CCCCAGCTCGTCAAGATTGGGCAGCGATTGGCAAGCTACAGGGAGGGCAAGCGACTTCGCGCTGTCATAGAGGAC
GTGGATAGTAGCTCAACAGTCCAGCCCGTTAGCTCTTTGACTACCAAGTCACAAGAACAAATCCACACTTCGACC
ACTATGACTTCAACCTTCACGCCCCAGGCTTCCGTCCAACCCACTCTAACTCCTACCGAGCAAGCCCAGCAAGTC
CGCGAGGAGATAGATTCGGACCTTTGGCGGTGGCAGGAAAGATTTTCTCTCGCGGCCGATAAAGGTATTGAAGAC
CTTGAGGGACGTATTGGGGAGATCGTGTCCGCCCTGGTTGCAAGCAGCGCGAACACCCATGGCCAGAGCCTTTCT
ACCGCTCTTCAGTCGGTTTCAGCCGAGCAGATTTCCTCCATGAAACAACGCATCAATGAACTTGCGGGTTCAATG
CCAGAGGTGGACGCCCCGGAGATCGAGAAGTCTACTAGCGACTTGCTGATTCGGGAAATCCGAACTTCTGCTATC
TCTGTGAGAGATCGCGCCCATGCACTCCGAGAGTGGTCTATCTCGTTCGAGGACGAACTCGTTCGCCGAGTCACT
GCTGCTGTCAATTCGACAATAGATGTTCTCGACAGCATTCGCAATCTAGGCTTACAAGAAATTGGCATGCGCTGG
GCGTGGATGGATGGTGTCACATACAAGGATTGGGCAAAGTACCATGCCCTCAAAGCCCAACTCGAGGAATGGCGT
AACGACATCCGAAATGTCGGCATGAACCACAAATCCGTATCTGACGCCAGAGCCGTGGCGAGTGATATCTTAGAT
CAAGGCATGCATGAAGCCGAACAAGCTGCCAGGGAACTTGTTCGGTTAAAGGATGTTGGGATCTGGAAGATCGCG
GCTCGTGAAGTAAGCGATCATTTTGAAACTCGCACCGAAGCCCCGCCAACAAGGCCCAAGGCCCAAGAAGAGACC
GAGGAATCTGACGAAGAAGCTGCCAAGATGGTTTTCGGTAACGATGAGTCTTCCGAAGAGGTGGCAACACCAATA
TCGGATGACGCTTACGAGGAAACCCCCTTTACCGATGAGCCTTCCGCGGCTGTCAATGCTGAAGCGGACTTTGAT
GGCGTTAACGAGTCTGTTATGGACGATGATATTGTGGTGGAAAACCAGCCCTCCGCAAGACCCGCCTTTGGTGTT
GCGGCTGCAGATGCAAATTTGCATCAAGCGCCTATCCTAGATGATGAGAGCCACAATGTCCAGGACAGTCTGGCA
AGTAAGGTTGGCGATACCTACGCCGGGGCCAGCGATGCTGTTAGCGAAGCTGTCTATGGTGCATCGACGACCAAC
GGAGTCGGTGAGAAGGTAGCATCATTGGCCAGTGAACAGTACTCTGTTGCTTGGTCCGCCGCCTCTACCGTTATC
CATGGCACCCCTCTCAGCCCTGTCGAAAAGGTTTACAGCGACGGCTCTGAGAAATATAGCGATGCTGTAGCCGCT
GCGTCGTCCGTCATCTACGGCACCCCAACACCGGTTGTCCAATCTTTGATGGACGGAGCCAGCTCAACATTTGCT
GATTCCACACATCAGGCTAAAGTACTCTATGAGATCGCGAAGTCTCAAGTTCTTAGCCGAATAGCCGAATCTAGC
GCTCCTGTTCATGTCCAGATTCTCGCTTCCATAGAGTCGGCCTATTCCGGGTCTCTAAAATACGCCACAGATGAG
CTGGAATCGAAGCTCCGCAGTGTTCGTGCTACCCCGACACCATCCAACGTCGGACCTCTGGCCCATATCTCATCC
ATTGCGTCTTCCCGGCTAAGCCATGGACTCAGCTTAGCATCTGAACAATTAGCTCGAGTGCAGCCACCAGCGACA
ACAGCCAGTATTCCTCAGGGCGGTCTCGAGCCATTCGTCCTTGATGCGCAGCGTCGCTACTACGAGGCAGTCGGG
TTGGCCCATGACCACTACTCTGTCTTTGTCTCTACGGCATCCGAGGCGGTCTATGGTTCTCCAACCCCCACACCA
GCCGGAAGCTCTAAGGGGATCATTGAGGAAGCAGGATCTCAATACGAGCATGTGTCCTCGTTAGTTTCTGCCAGC
CTTGCCGCTGTCGTCGCATCTGCAAGCTCGGTCATGTCTTCCGCAGATGGCGGCAAAGCACAAAGTATTGTTGAA
GATGCTTCATCCCGATACAATGCTGCCCTCTCTGCGGCTTCTTCGTCTCTCTCTGTGGCTTCCATTTCCGCTAGC
TCTGTCATCCACGGAACCTCCACGGGCCCTGTAGAGTCCCTTTATAGCCAAGTACCTGAAAAATGGGAAAGCCTC
ATCTCGAAAGCCAGTGAGCAGATTTATGGTGCGCCAACGCCGTTTCTGCAGCAAGTGGTGAATAATGGGCGTCCG
CAGTTTGAGGCAGTCCAAGGGCTTGTCTCTGAACTGATTGCGGGCAAGCAACCTTCATATACGGAGAGTGTGCTG
AGCAAACTGAGAGCCGCATATGAGACGCCGTACCCGGCTGTCGCTTTCTCGTCTGCCTCTAGCTACGTTAATGAG
GCTTATGGATCTGCGTCCTCCGTCGCTGCTTCTGTTATTTCAGAAGCCCCGAGCGTAGAGGACATCATACAACAC
GCGAATAACCAACTCCGTGCTGCTGTCGAAACCGCCAGCGTTGGTATCTACGGAACCCCCAAGGGTTCCTACGAG
AAAGCCACTGATGCCGCAGCTGATGCGTACTCAACAGCATCGGCTCAGATCATTAGCGCAGTTTACGGCAAGGAA
TCGAGTTACCTCGATGTCGCTAAGGATGCCATTGAGAATATTCAATCTACAGCCAGCGCTGCTATCTACGGCAAG
GAACCCAGCGCAGTGGAGAGTGCAGCTATTCGTCTCGCTAGAGCCAAAAAGGACGCCATGTCTCAGCTGGCTGAT
CTAGCCGCCAATCTACCGGCTAGCAACGTTATCTTCGAGGCAGTCGAGACCGCCACAGCCCACCTTAAAGATACA
ACAAGCAGCATCAAGAGTTCCGCAGTTTCAGTCAAAGATGAACTTTGA
Transcript >Pro_DTO377G3_2|g4226.t1
ATGGTAGTGAAAGGGAATGAAGTGACGGATGTCACGACCAAAGCAAAGGGCCGAATGGATCTTGAAAAGCCACGG
AGAAAGGGCTTCGTCCGATGGACAATCGGACTTATCGTGAGGCTATGTATCTGGTACGCACTCTTGACGCCATTT
TTCAGGTGCCCAACCCATCTCGAAGACCTCACAGAGACATCACCTCGAGTCTGCAAGCCCTACCTGATTGCTCGT
TCACACGTGGAACCTTATGTGACGCCATATTATGATATTTATGCGGCGCCTTACGTTGATCAAGCCCGGCCTTAC
GTGAAAGTTTTTAATCAGCGAGTTTATACCCCTGCATCAAAATTTACCAAATCAGGATATGAGAAGTATGGAGCG
CCGACATTGAAGCAAGCTCAGGCATATGGGATTGAGCAATGGGAACATCAAGTCTCACCAAGACTACGGACTGCT
CAAAATAAGGTTCACCAGGTTTACTTAGCCAAGATTGATCCCCACGTCCAGCAAAGCGTTGATGTTGTCTCTCCA
TACTGCCAATGGGCCAGCACCGTTGTGCTCAATGTCTATCAGGGCCAACTGGTCCCTTTCTACGCGCGTTCAAAA
CCTTTCATCGGGAAAGTTTACTCCACCGGCCAGGGTATTTTGGCAACCCATGTCATGCCCGGGGCGCAGTATACC
TGGTCATCCGCGATCTACTTTGCTAACAGCTCACTATGGCCTCACGTTACTGGTCTTTACTCTGAACAAGTGGAG
CCCCAGCTCGTCAAGATTGGGCAGCGATTGGCAAGCTACAGGGAGGGCAAGCGACTTCGCGCTGTCATAGAGGAC
GTGGATAGTAGCTCAACAGTCCAGCCCGTTAGCTCTTTGACTACCAAGTCACAAGAACAAATCCACACTTCGACC
ACTATGACTTCAACCTTCACGCCCCAGGCTTCCGTCCAACCCACTCTAACTCCTACCGAGCAAGCCCAGCAAGTC
CGCGAGGAGATAGATTCGGACCTTTGGCGGTGGCAGGAAAGATTTTCTCTCGCGGCCGATAAAGGTATTGAAGAC
CTTGAGGGACGTATTGGGGAGATCGTGTCCGCCCTGGTTGCAAGCAGCGCGAACACCCATGGCCAGAGCCTTTCT
ACCGCTCTTCAGTCGGTTTCAGCCGAGCAGATTTCCTCCATGAAACAACGCATCAATGAACTTGCGGGTTCAATG
CCAGAGGTGGACGCCCCGGAGATCGAGAAGTCTACTAGCGACTTGCTGATTCGGGAAATCCGAACTTCTGCTATC
TCTGTGAGAGATCGCGCCCATGCACTCCGAGAGTGGTCTATCTCGTTCGAGGACGAACTCGTTCGCCGAGTCACT
GCTGCTGTCAATTCGACAATAGATGTTCTCGACAGCATTCGCAATCTAGGCTTACAAGAAATTGGCATGCGCTGG
GCGTGGATGGATGGTGTCACATACAAGGATTGGGCAAAGTACCATGCCCTCAAAGCCCAACTCGAGGAATGGCGT
AACGACATCCGAAATGTCGGCATGAACCACAAATCCGTATCTGACGCCAGAGCCGTGGCGAGTGATATCTTAGAT
CAAGGCATGCATGAAGCCGAACAAGCTGCCAGGGAACTTGTTCGGTTAAAGGATGTTGGGATCTGGAAGATCGCG
GCTCGTGAAGTAAGCGATCATTTTGAAACTCGCACCGAAGCCCCGCCAACAAGGCCCAAGGCCCAAGAAGAGACC
GAGGAATCTGACGAAGAAGCTGCCAAGATGGTTTTCGGTAACGATGAGTCTTCCGAAGAGGTGGCAACACCAATA
TCGGATGACGCTTACGAGGAAACCCCCTTTACCGATGAGCCTTCCGCGGCTGTCAATGCTGAAGCGGACTTTGAT
GGCGTTAACGAGTCTGTTATGGACGATGATATTGTGGTGGAAAACCAGCCCTCCGCAAGACCCGCCTTTGGTGTT
GCGGCTGCAGATGCAAATTTGCATCAAGCGCCTATCCTAGATGATGAGAGCCACAATGTCCAGGACAGTCTGGCA
AGTAAGGTTGGCGATACCTACGCCGGGGCCAGCGATGCTGTTAGCGAAGCTGTCTATGGTGCATCGACGACCAAC
GGAGTCGGTGAGAAGGTAGCATCATTGGCCAGTGAACAGTACTCTGTTGCTTGGTCCGCCGCCTCTACCGTTATC
CATGGCACCCCTCTCAGCCCTGTCGAAAAGGTTTACAGCGACGGCTCTGAGAAATATAGCGATGCTGTAGCCGCT
GCGTCGTCCGTCATCTACGGCACCCCAACACCGGTTGTCCAATCTTTGATGGACGGAGCCAGCTCAACATTTGCT
GATTCCACACATCAGGCTAAAGTACTCTATGAGATCGCGAAGTCTCAAGTTCTTAGCCGAATAGCCGAATCTAGC
GCTCCTGTTCATGTCCAGATTCTCGCTTCCATAGAGTCGGCCTATTCCGGGTCTCTAAAATACGCCACAGATGAG
CTGGAATCGAAGCTCCGCAGTGTTCGTGCTACCCCGACACCATCCAACGTCGGACCTCTGGCCCATATCTCATCC
ATTGCGTCTTCCCGGCTAAGCCATGGACTCAGCTTAGCATCTGAACAATTAGCTCGAGTGCAGCCACCAGCGACA
ACAGCCAGTATTCCTCAGGGCGGTCTCGAGCCATTCGTCCTTGATGCGCAGCGTCGCTACTACGAGGCAGTCGGG
TTGGCCCATGACCACTACTCTGTCTTTGTCTCTACGGCATCCGAGGCGGTCTATGGTTCTCCAACCCCCACACCA
GCCGGAAGCTCTAAGGGGATCATTGAGGAAGCAGGATCTCAATACGAGCATGTGTCCTCGTTAGTTTCTGCCAGC
CTTGCCGCTGTCGTCGCATCTGCAAGCTCGGTCATGTCTTCCGCAGATGGCGGCAAAGCACAAAGTATTGTTGAA
GATGCTTCATCCCGATACAATGCTGCCCTCTCTGCGGCTTCTTCGTCTCTCTCTGTGGCTTCCATTTCCGCTAGC
TCTGTCATCCACGGAACCTCCACGGGCCCTGTAGAGTCCCTTTATAGCCAAGTACCTGAAAAATGGGAAAGCCTC
ATCTCGAAAGCCAGTGAGCAGATTTATGGTGCGCCAACGCCGTTTCTGCAGCAAGTGGTGAATAATGGGCGTCCG
CAGTTTGAGGCAGTCCAAGGGCTTGTCTCTGAACTGATTGCGGGCAAGCAACCTTCATATACGGAGAGTGTGCTG
AGCAAACTGAGAGCCGCATATGAGACGCCGTACCCGGCTGTCGCTTTCTCGTCTGCCTCTAGCTACGTTAATGAG
GCTTATGGATCTGCGTCCTCCGTCGCTGCTTCTGTTATTTCAGAAGCCCCGAGCGTAGAGGACATCATACAACAC
GCGAATAACCAACTCCGTGCTGCTGTCGAAACCGCCAGCGTTGGTATCTACGGAACCCCCAAGGGTTCCTACGAG
AAAGCCACTGATGCCGCAGCTGATGCGTACTCAACAGCATCGGCTCAGATCATTAGCGCAGTTTACGGCAAGGAA
TCGAGTTACCTCGATGTCGCTAAGGATGCCATTGAGAATATTCAATCTACAGCCAGCGCTGCTATCTACGGCAAG
GAACCCAGCGCAGTGGAGAGTGCAGCTATTCGTCTCGCTAGAGCCAAAAAGGACGCCATGTCTCAGCTGGCTGAT
CTAGCCGCCAATCTACCGGCTAGCAACGTTATCTTCGAGGCAGTCGAGACCGCCACAGCCCACCTTAAAGATACA
ACAAGCAGCATCAAGAGTTCCGCAGTTTCAGTCAAAGATGAACTTTGA
Gene >Pro_DTO377G3_2|g4226.t1
ATGGTAGTGAAAGGGAATGAAGTGACGGATGTCACGACCAAAGCAAAGGGCCGAATGGATCTTGAAAAGCCACGG
AGAAAGGGCTTCGTCCGATGGACAATCGGACTTATCGTGAGGTGAGTGATAGCATCGCCATACTTGTATACAGCG
AAAAGCCCCTTTTAACATCTTCACTTCTCAGGCTATGTATCTGGTACGCACTCTTGACGCCATTTTTCAGGTGCC
CAACCCATCTCGAAGACCTCACAGAGACATCACCTCGAGTCTGCAAGCCCTACCTGATTGCTCGTTCACACGTGG
AACCTTATGTGACGCCATATTATGATATTTATGCGGCGCCTTACGTTGATCAAGCCCGGCCTTACGTGAAAGTTT
TTAATCAGCGAGTTTATACCCCTGCATCAAAATTTACCAAATCAGGATATGAGAAGTATGGAGCGCCGACATTGA
AGCAAGCTCAGGCATATGGGATTGAGCAATGGGAACATCAAGTCTCACCAAGACTACGGACTGCTCAAAATAAGG
TTCACCAGGTTTACTTAGCCAAGATTGATCCCCACGTCCAGCAAAGCGTTGATGTTGTCTCTCCATACTGCCAAT
GGGCCAGCACCGTTGTGCTCAATGTCTATCAGGGCCAACTGGTCCCTTTCTACGCGCGTTCAAAACCTTTCATCG
GGAAAGTTTACTCCACCGGCCAGGGTATTTTGGCAACCCATGTCATGCCCGGGGCGCAGTATACCTGGTCATCCG
CGATCTACTTTGCTAACAGCTCACTATGGCCTCACGTTACTGGTCTTTACTCTGAACAAGTGGAGCCCCAGCTCG
TCAAGATTGGGCAGCGATTGGCAAGCTACAGGGAGGGCAAGCGACTTCGCGCTGTCATAGAGGACGTGGATAGGT
ACATAAAAGTTCCTTGGTTTATCCAGTCCATAGCATGCTGACCATAAAATTTAGTAGCTCAACAGTCCAGCCCGT
TAGCTCTTTGACTACCAAGTCACAAGAACAAATCCACACTTCGACCACTATGACTTCAACCTTCACGCCCCAGGC
TTCCGTCCAACCCACTCTAACTCCTACCGAGCAAGCCCAGCAAGTCCGCGAGGAGATAGATTCGGACCTTTGGCG
GTGGCAGGAAAGATTTTCTCTCGCGGCCGATAAAGGTATTGAAGACCTTGAGGGACGTATTGGGGAGATCGTGTC
CGCCCTGGTTGCAAGCAGCGCGAACACCCATGGCCAGAGCCTTTCTACCGCTCTTCAGTCGGTTTCAGCCGAGCA
GATTTCCTCCATGAAACAACGCATCAATGAACTTGCGGGTTCAATGCCAGAGGTGGACGCCCCGGAGATCGAGAA
GTCTACTAGCGACTTGCTGATTCGGGAAATCCGAACTTCTGCTATCTCTGTGAGAGATCGCGCCCATGCACTCCG
AGAGTGGTCTATCTCGTTCGAGGACGAACTCGTTCGCCGAGTCACTGCTGCTGTCAATTCGACAATAGATGTTCT
CGACAGCATTCGCAATCTAGGCTTACAAGAAATTGGCATGCGCTGGGCGTGGATGGATGGTGTCACATACAAGGA
TTGGGCAAAGTACCATGCCCTCAAAGCCCAACTCGAGGAATGGCGTAACGACATCCGAAATGTCGGCATGAACCA
CAAATCCGTATCTGACGCCAGAGCCGTGGCGAGTGATATCTTAGATCAAGGCATGCATGAAGCCGAACAAGCTGC
CAGGGAACTTGTTCGGTTAAAGGATGTTGGGATCTGGAAGATCGCGGCTCGTGAAGTAAGCGATCATTTTGAAAC
TCGCACCGAAGCCCCGCCAACAAGGCCCAAGGCCCAAGAAGAGACCGAGGAATCTGACGAAGAAGCTGCCAAGAT
GGTTTTCGGTAACGATGAGTCTTCCGAAGAGGTGGCAACACCAATATCGGATGACGCTTACGAGGAAACCCCCTT
TACCGATGAGCCTTCCGCGGCTGTCAATGCTGAAGCGGACTTTGATGGCGTTAACGAGTCTGTTATGGACGATGA
TATTGTGGTGGAAAACCAGCCCTCCGCAAGACCCGCCTTTGGTGTTGCGGCTGCAGATGCAAATTTGCATCAAGC
GCCTATCCTAGATGATGAGAGCCACAATGTCCAGGACAGTCTGGCAAGTAAGGTTGGCGATACCTACGCCGGGGC
CAGCGATGCTGTTAGCGAAGCTGTCTATGGTGCATCGACGACCAACGGAGTCGGTGAGAAGGTAGCATCATTGGC
CAGTGAACAGTACTCTGTTGCTTGGTCCGCCGCCTCTACCGTTATCCATGGCACCCCTCTCAGCCCTGTCGAAAA
GGTTTACAGCGACGGCTCTGAGAAATATAGCGATGCTGTAGCCGCGTAAGTAGTATAGCATATTCAGCGTGTTTC
AAAACTGCACAAAAATCGAATTATCGCTAATGCGAGTTTCTGCCACAGTGCGTCGTCCGTCATCTACGGCACCCC
AACACCGGTTGTCCAATCTTTGATGGACGGAGCCAGCTCAACATTTGCTGATTCCACACATCAGGCTAAAGTACT
CTATGAGATCGCGAAGTCTCAAGTTCTTAGCCGAATAGCCGAATCTAGCGCTCCTGTTCATGTCCAGATTCTCGC
TTCCATAGAGTCGGCCTATTCCGGGTCTCTAAAATACGCCACAGATGAGCTGGAATCGAAGCTCCGCAGTGTTCG
TGCTACCCCGACACCATCCAACGTCGGACCTCTGGCCCATATCTCATCCATTGCGTCTTCCCGGCTAAGCCATGG
ACTCAGCTTAGCATCTGAACAATTAGCTCGAGTGCAGCCACCAGCGACAACAGCCAGTATTCCTCAGGGCGGTCT
CGAGCCATTCGTCCTTGATGCGCAGCGTCGCTACTACGAGGCAGTCGGGTTGGCCCATGACCACTACTCTGTCTT
TGTCTCTACGGCATCCGAGGCGGTCTATGGTTCTCCAACCCCCACACCAGCCGGAAGCTCTAAGGGGATCATTGA
GGAAGCAGGATCTCAATACGAGCATGTGTCCTCGTTAGTTTCTGCCAGCCTTGCCGCTGTCGTCGCATCTGCAAG
CTCGGTCATGTCTTCCGCAGATGGCGGCAAAGCACAAAGTATTGTTGAAGATGCTTCATCCCGATACAATGCTGC
CCTCTCTGCGGCTTCTTCGTCTCTCTCTGTGGCTTCCATTTCCGCTAGCTCTGTCATCCACGGAACCTCCACGGG
CCCTGTAGAGTCCCTTTATAGCCAAGTACCTGAAAAATGGGAAAGCCTCATCTCGAAAGCCAGTGAGCAGATTTA
TGGTGCGCCAACGCCGTTTCTGCAGCAAGTGGTGAATAATGGGCGTCCGCAGTTTGAGGCAGTCCAAGGGCTTGT
CTCTGAACTGATTGCGGGCAAGCAACCTTCATATACGGAGAGTGTGCTGAGCAAACTGAGAGCCGCATATGAGAC
GCCGTACCCGGCTGTCGCTTTCTCGTCTGCCTCTAGCTACGTTAATGAGGCTTATGGATCTGCGTCCTCCGTCGC
TGCTTCTGTTATTTCAGAAGCCCCGAGCGTAGAGGACATCATACAACACGCGAATAACCAACTCCGTGCTGCTGT
CGAAACCGCCAGCGTTGGTATCTACGGAACCCCCAAGGGTTCCTACGAGAAAGCCACTGATGCCGCAGCTGATGC
GTACTCAACAGCATCGGCTCAGATCATTAGCGCAGTTTACGGCAAGGAATCGAGTTACCTCGATGTCGCTAAGGA
TGCCATTGAGAATATTCAATCTACAGCCAGCGCTGCTATCTACGGCAAGGAACCCAGCGCAGTGGAGAGTGCAGC
TATTCGTCTCGCTAGAGCCAAAAAGGACGCCATGTCTCAGCTGGCTGATCTAGCCGCCAATCTACCGGCTAGCAA
CGTTATCTTCGAGGCAGTCGAGACCGCCACAGCCCACCTTAAAGATACAACAAGCAGCATCAAGAGTTCCGCAGT
TTCAGTCAAAGATGAACTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail