Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4221.t1
Gene name
Locationscaffold_08:379368..380228
Strand-
Gene length (bp)860
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01174 SNO SNO glutamine amidotransferase family 1.4E-44 7 177
PF01174 SNO SNO glutamine amidotransferase family 2.0E-07 220 255
PF07685 GATase_3 CobB/CobQ-like glutamine amidotransferase domain 6.7E-08 35 130

GO

GO Term Description Terminal node
GO:0042823 pyridoxal phosphate biosynthetic process Yes
GO:0009236 cobalamin biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0042819 vitamin B6 biosynthetic process Yes
GO:0004359 glutaminase activity Yes
GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides No
GO:0009987 cellular process No
GO:0019637 organophosphate metabolic process No
GO:0006081 cellular aldehyde metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0042822 pyridoxal phosphate metabolic process No
GO:0051188 cofactor biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0033014 tetrapyrrole biosynthetic process No
GO:0009235 cobalamin metabolic process No
GO:0051186 cofactor metabolic process No
GO:0042816 vitamin B6 metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0046483 heterocycle metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006766 vitamin metabolic process No
GO:0006732 coenzyme metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0072525 pyridine-containing compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0046184 aldehyde biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0006767 water-soluble vitamin metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0016787 hydrolase activity No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:0009110 vitamin biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0009108 coenzyme biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0033013 tetrapyrrole metabolic process No
GO:0072524 pyridine-containing compound metabolic process No
GO:0017144 drug metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4221.t1
MAITVGVLALQGAFFEHVQLLKKAAEQVTPSEWHFIEVRTPQELATCDGLVLPGGESTTMSLVAARSNLLEPLRE
FVKVDRKPTWGTCAGLILLAESANKTKKGGQELIGGLDVRVNRNHFGRQTESFQGPLDLPFLGQDAPPFPAVFIR
APIVEKILPHHEGIQKEEIQQEDVVVAPSREARDSVAQAATAEHVEVLATLVRPAAQPATGGGDINSDRGSGDIV
AVRQGNVFGTSFHPELTGDARIHTWWLREVQAAVLKRDKLKQ*
Coding >Pro_DTO377G3_2|g4221.t1
ATGGCTATCACTGTTGGAGTTCTGGCCCTGCAGGGCGCTTTTTTTGAGCATGTGCAGCTTTTGAAAAAAGCCGCT
GAGCAAGTGACGCCGTCGGAATGGCACTTCATCGAAGTACGAACGCCACAAGAACTGGCAACATGCGATGGCCTG
GTCTTGCCCGGAGGCGAGAGTACCACCATGTCTTTGGTCGCAGCAAGGTCAAATCTCCTCGAGCCATTGCGGGAA
TTTGTAAAAGTGGATCGCAAACCAACTTGGGGTACATGCGCCGGGCTCATTTTGCTCGCCGAGTCTGCCAACAAG
ACAAAAAAAGGAGGGCAAGAGCTGATCGGTGGTCTTGATGTGCGAGTGAACCGAAACCACTTCGGTCGACAGACA
GAAAGCTTCCAAGGCCCGTTGGATCTGCCATTCTTGGGTCAGGACGCGCCTCCCTTCCCAGCAGTATTCATTCGA
GCCCCTATCGTCGAAAAGATTCTTCCCCATCATGAGGGCATCCAAAAAGAAGAGATTCAACAGGAAGATGTTGTC
GTGGCACCATCCAGAGAAGCACGGGACTCAGTGGCGCAAGCAGCAACAGCAGAGCACGTTGAGGTACTAGCAACA
TTAGTGAGACCGGCAGCTCAACCCGCCACGGGGGGTGGAGATATCAATTCAGACCGGGGAAGTGGCGACATTGTT
GCAGTGCGACAGGGCAATGTATTCGGCACCAGCTTTCACCCGGAGCTGACAGGTGACGCAAGAATCCACACTTGG
TGGTTGCGCGAAGTTCAAGCAGCAGTGCTGAAACGAGACAAGTTAAAGCAATAA
Transcript >Pro_DTO377G3_2|g4221.t1
ATGGCTATCACTGTTGGAGTTCTGGCCCTGCAGGGCGCTTTTTTTGAGCATGTGCAGCTTTTGAAAAAAGCCGCT
GAGCAAGTGACGCCGTCGGAATGGCACTTCATCGAAGTACGAACGCCACAAGAACTGGCAACATGCGATGGCCTG
GTCTTGCCCGGAGGCGAGAGTACCACCATGTCTTTGGTCGCAGCAAGGTCAAATCTCCTCGAGCCATTGCGGGAA
TTTGTAAAAGTGGATCGCAAACCAACTTGGGGTACATGCGCCGGGCTCATTTTGCTCGCCGAGTCTGCCAACAAG
ACAAAAAAAGGAGGGCAAGAGCTGATCGGTGGTCTTGATGTGCGAGTGAACCGAAACCACTTCGGTCGACAGACA
GAAAGCTTCCAAGGCCCGTTGGATCTGCCATTCTTGGGTCAGGACGCGCCTCCCTTCCCAGCAGTATTCATTCGA
GCCCCTATCGTCGAAAAGATTCTTCCCCATCATGAGGGCATCCAAAAAGAAGAGATTCAACAGGAAGATGTTGTC
GTGGCACCATCCAGAGAAGCACGGGACTCAGTGGCGCAAGCAGCAACAGCAGAGCACGTTGAGGTACTAGCAACA
TTAGTGAGACCGGCAGCTCAACCCGCCACGGGGGGTGGAGATATCAATTCAGACCGGGGAAGTGGCGACATTGTT
GCAGTGCGACAGGGCAATGTATTCGGCACCAGCTTTCACCCGGAGCTGACAGGTGACGCAAGAATCCACACTTGG
TGGTTGCGCGAAGTTCAAGCAGCAGTGCTGAAACGAGACAAGTTAAAGCAATAA
Gene >Pro_DTO377G3_2|g4221.t1
ATGGCTATCACTGTTGGAGTTCTGGCCCTGCAGGGCGCTTTTTTTGAGCATGTGCAGCTTTTGAAAAAAGCCGCT
GAGCAAGTGACGCCGTCGGAATGGCACTTCATCGAAGTACGAACGCCACAAGAACTGGCAACATGCGATGGCCTG
GTCTTGCCCGGAGGCGAGAGTACCACCATGTCTTTGGTCGCAGCAAGGTCAAATCTCCTCGAGCCATTGCGGGAA
TTTGTAAAGTAAGTGAATTTGATTAGTTCATATGAATTCAATCTAATACGTTGGGTATGTGTAGAGTGGATCGCA
AACCAACTTGGGGTACATGCGCCGGGCTCATTTTGCTCGCCGAGTCTGCCAACAAGACAAAAAAAGGAGGGCAAG
AGCTGATCGGTGGTCTTGATGTGCGAGTGAACCGAAACCACTTCGGTCGACAGACAGAAAGCTTCCAAGGCCCGT
TGGATCTGCCATTCTTGGGTCAGGACGCGCCTCCCTTCCCAGCAGTATTCATTCGAGCCCCTATCGTCGAAAAGA
TTCTTCCCCATCATGAGGGCATCCAAAAAGAAGAGATTCAACAGGAAGATGTTGTCGTGGCACCATCCAGAGAAG
CACGGGACTCAGTGGCGCAAGCAGCAACAGCAGAGCACGTTGAGGTACTAGCAACATTAGTGAGACCGGCAGCTC
AACCCGCCACGGGGGGTGGAGATATCAATTCAGACCGGGGAAGTGGCGACATTGTTGCAGTGCGACAGGGCAATG
TATTCGGCACCAGCTTTCACCCGGAGCTGACAGGTGACGCAAGAATCCACACTTGGTGGTTGCGCGAAGTTCAAG
CAGCAGTGCTGAAACGAGACAAGTTAAAGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail