Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4220.t1
Gene name
Locationscaffold_08:378432..379220
Strand+
Gene length (bp)788
Transcript length (bp)537
Coding sequence length (bp)537
Protein length (aa) 179

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.7E-15 52 121

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 125.99 71.53 180.45
5d_25C Five days - 25 degrees Celsius 126.39 70.95 181.82
7d_25C Seven days - 25 degrees Celsius 114.91 63.11 166.70
10d_25C Ten days - 25 degrees Celsius 105.51 56.97 154.04
7d_15C Seven days - 15 degrees Celsius 121.54 68.11 174.98
7d_30C Seven days - 30 degrees Celsius 108.65 59.69 157.62

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.993930 no
3d_25C 7d_25C 0.781258 no
3d_25C 7d_15C 0.921381 no
3d_25C 7d_30C 0.627342 no
3d_25C 10d_25C 0.550657 no
5d_25C 7d_25C 0.780279 no
5d_25C 7d_15C 0.918431 no
5d_25C 7d_30C 0.627300 no
5d_25C 10d_25C 0.553476 no
7d_25C 7d_15C 0.881577 no
7d_25C 7d_30C 0.884684 no
7d_25C 10d_25C 0.812633 no
7d_15C 7d_30C 0.733122 no
7d_15C 10d_25C 0.656771 no
7d_30C 10d_25C 0.943320 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4220.t1
MSLLAVNTVDRLDRPSAYYVSKNKRRRYNDREEEEPQQQEKPDDKLKNATTLYVGNLSFYTTEEQIHELFAKCGE
IKRLVMGLDRFNKTPCGFCFVEYYTHQDALDCLKYIGGTKLDERIIRTDLDPGFEEGRQFGRGKSGGQVRDEYRE
EYDPGRGGYGRAYDEQRQREEDEYGAGR*
Coding >Pro_DTO377G3_2|g4220.t1
ATGAGTTTGCTGGCTGTAAACACGGTCGACCGACTGGATCGACCAAGCGCCTACTACGTCAGCAAGAACAAGCGA
CGCAGATACAATGATCGTGAGGAGGAGGAACCGCAGCAACAGGAGAAACCCGATGACAAATTGAAAAATGCGACA
ACCCTCTACGTGGGAAATCTTTCGTTTTATACCACCGAGGAACAGATTCATGAACTCTTCGCCAAGTGCGGCGAG
ATCAAGCGACTTGTAATGGGCCTCGACCGATTCAACAAAACACCCTGCGGCTTTTGCTTTGTCGAGTATTATACC
CATCAGGATGCGCTAGATTGCTTGAAGTACATCGGAGGAACCAAGCTGGACGAGCGGATCATTCGGACAGACCTT
GACCCTGGATTTGAAGAAGGACGGCAATTTGGACGAGGCAAATCGGGCGGTCAAGTGCGCGATGAATACCGCGAA
GAATACGATCCGGGCCGTGGTGGATATGGCCGCGCCTATGATGAGCAGCGCCAGCGCGAGGAGGACGAATACGGT
GCTGGAAGATAG
Transcript >Pro_DTO377G3_2|g4220.t1
ATGAGTTTGCTGGCTGTAAACACGGTCGACCGACTGGATCGACCAAGCGCCTACTACGTCAGCAAGAACAAGCGA
CGCAGATACAATGATCGTGAGGAGGAGGAACCGCAGCAACAGGAGAAACCCGATGACAAATTGAAAAATGCGACA
ACCCTCTACGTGGGAAATCTTTCGTTTTATACCACCGAGGAACAGATTCATGAACTCTTCGCCAAGTGCGGCGAG
ATCAAGCGACTTGTAATGGGCCTCGACCGATTCAACAAAACACCCTGCGGCTTTTGCTTTGTCGAGTATTATACC
CATCAGGATGCGCTAGATTGCTTGAAGTACATCGGAGGAACCAAGCTGGACGAGCGGATCATTCGGACAGACCTT
GACCCTGGATTTGAAGAAGGACGGCAATTTGGACGAGGCAAATCGGGCGGTCAAGTGCGCGATGAATACCGCGAA
GAATACGATCCGGGCCGTGGTGGATATGGCCGCGCCTATGATGAGCAGCGCCAGCGCGAGGAGGACGAATACGGT
GCTGGAAGATAG
Gene >Pro_DTO377G3_2|g4220.t1
ATGAGTTTGCTGGCTGTAAACACGGTCGACCGACTGGATCGACCAAGCGCCTACTACGTCAGCAAGGTGAGTACT
CGCCCTGGACTGACTGCCCTTTACCAAGCTGTGTCGAAACCAGTCCAAATAGGCTATAGAGGCTGAACAAACTGT
CCACAGAACAAGCGACGCAGATACAATGATCGTGAGGAGGAGGAACCGCAGCAACAGGAGAAACCCGATGACAAA
TTGAAAAATGCGACAACCCTCTACGTGGGAAATCTGTATGCAAGCATGCAATAACTTAGACGCAATTGTCTTACT
AACCAACCCAAGTTCGTTTTATACCACCGAGGAACAGATTCATGAACTCTTCGCCAAGTGAGAATGCGCTTTCGA
GTCTCTTCGAATTATGATTAACCTCGAATTCTAGGTGCGGCGAGATCAAGCGACTTGTAATGGGCCTCGACCGAT
TCAACAAAACACCCTGCGGCTTTTGCTTTGTCGAGTATTATACCCATCAGGATGCGCTAGATTGCTTGAAGTACA
TCGGAGGAACCAAGCTGGACGAGCGGATCATTCGGACAGACCTTGACCCTGGATTTGAAGAAGGACGGCAATTTG
GGTATGTGGTCTTCACCAATGGCGGCTTTAAGCTCGTACTTACTGACTTTCGCTGCAGACGAGGCAAATCGGGCG
GTCAAGTGCGCGATGAATACCGCGAAGAATACGATCCGGGCCGTGGTGGATATGGCCGCGCCTATGATGAGCAGC
GCCAGCGCGAGGAGGACGAATACGGTGCTGGAAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail