Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g421.t1
Gene name
Locationscaffold_01:1068841..1070938
Strand+
Gene length (bp)2097
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00514 Arm Armadillo/beta-catenin-like repeat 3.5E-04 108 134
PF00514 Arm Armadillo/beta-catenin-like repeat 8.7E-10 136 175
PF00514 Arm Armadillo/beta-catenin-like repeat 7.9E-09 178 216
PF00514 Arm Armadillo/beta-catenin-like repeat 2.9E-13 218 257
PF00514 Arm Armadillo/beta-catenin-like repeat 3.4E-05 267 301
PF00514 Arm Armadillo/beta-catenin-like repeat 7.0E-08 348 384
PF00514 Arm Armadillo/beta-catenin-like repeat 6.9E-06 428 467
PF04826 Arm_2 Armadillo-like 4.5E-08 105 287
PF05804 KAP Kinesin-associated protein (KAP) 8.7E-10 150 395

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g421.t1
MSGIANACLSCFSAVDQWCHITACLGPIGARSRDGIYETTLADNEREAVSDLLGYLENRAETDFFHGEPLRALST
LVYSENVDLQRSASLTFAEITERDVREVDRDTLEPILFLLQSSDIEVQRAASAALGNLAVNSENKVLIVTLGGLS
PLIRQMMSPNVEVQCNAVGCITNLATHEENKAKIARSGALGPLIRLAKSKDMRVQRNATGALLNMTHSDDNRQQL
VNAGAIPVLVHLLSSPDVDVQYYCTTALSNIAVDSTNRKRLAQTESRLVQSLVHLMDSSTPKVQCQAALALRNLA
SDEKYQLEIVRAKGLSPLLRLLQSSYLPLILSAVACIRNISIHPLNESPIIEAGFLKPLVDLLGSTDNEEIQCHA
ISTLRNLAASSDRNKELVLQAGAVQKCKDLVLRVPLTVQSEMTAAIAVLALSEELKPHLLNLGVFDVLIPLTNSE
SIEVQGNSAAALGNLSSKVGDYSMFVRDWADANGGIHGYLHRFLASGDPTFQHIAIWTLLQLLESEDKKLIGYIS
RSENIVNLVKVISDKNIDSDEEDIDDGEGEVITLARRCLELVGAGPKQTLVEA*
Coding >Pro_DTO377G3_2|g421.t1
ATGAGTGGAATCGCGAATGCCTGTCTGTCTTGCTTTTCAGCAGTGGACCAATGGTGTCATATCACAGCATGTCTC
GGTCCCATCGGAGCTCGTTCTCGAGATGGTATCTACGAAACAACCCTGGCCGATAATGAGCGAGAAGCGGTATCA
GATCTTCTAGGCTACTTGGAGAACCGCGCAGAGACCGACTTCTTCCACGGCGAGCCACTACGAGCCTTGAGTACC
CTTGTTTATTCCGAAAACGTCGACCTGCAAAGAAGCGCCAGCTTGACGTTTGCTGAGATCACAGAGCGAGATGTG
CGCGAGGTCGATCGCGATACCCTCGAACCTATCCTCTTTCTACTTCAAAGCTCAGATATCGAAGTTCAACGGGCT
GCTAGTGCAGCGCTGGGCAATCTCGCCGTAAATTCTGAGAACAAGGTCTTGATCGTCACCCTCGGGGGCCTATCT
CCCTTGATTCGCCAGATGATGTCGCCCAATGTCGAGGTACAGTGCAATGCGGTCGGATGTATAACCAATCTCGCG
ACCCATGAGGAGAACAAGGCCAAGATTGCTCGCTCTGGCGCTCTAGGTCCTCTCATTCGCCTGGCCAAGTCGAAG
GATATGCGTGTCCAGCGAAACGCGACGGGCGCACTGCTTAACATGACTCATTCGGATGACAACCGACAGCAACTT
GTCAATGCCGGCGCTATTCCCGTGCTCGTGCACCTCCTCTCATCCCCCGACGTTGACGTACAGTACTACTGCACA
ACAGCTCTCAGCAATATCGCCGTTGACTCGACGAATCGCAAACGACTCGCCCAAACCGAGTCACGCCTCGTGCAA
TCATTAGTTCACCTTATGGATTCATCCACTCCGAAAGTCCAATGTCAAGCGGCGCTCGCCCTGCGCAATCTCGCC
TCTGATGAGAAATACCAGCTTGAAATAGTTCGGGCGAAGGGCCTTTCTCCACTGCTACGACTCCTACAATCCTCC
TACCTTCCTCTCATCTTATCCGCCGTCGCTTGTATCCGCAACATTTCTATTCATCCTCTTAACGAATCCCCCATT
ATCGAAGCGGGCTTCTTGAAGCCGTTGGTGGATCTCCTAGGCTCGACTGACAACGAAGAGATTCAATGTCACGCT
ATATCCACGCTTCGTAACCTTGCTGCTAGCTCTGATCGCAACAAAGAACTTGTCCTGCAGGCCGGAGCAGTACAA
AAGTGCAAGGACTTGGTCTTGCGTGTTCCCCTAACAGTCCAATCTGAGATGACTGCTGCAATCGCTGTGCTGGCC
CTCAGCGAGGAGCTGAAGCCGCATCTTCTCAACCTCGGAGTGTTTGACGTCTTGATTCCTCTGACAAACTCTGAA
AGTATTGAGGTGCAAGGCAACAGCGCGGCTGCGTTGGGCAATCTGTCTTCGAAAGTCGGCGATTATTCGATGTTC
GTTCGCGACTGGGCAGACGCCAATGGTGGCATCCATGGCTACCTCCATCGCTTCCTTGCCAGTGGAGATCCCACA
TTCCAGCACATTGCCATCTGGACCCTCCTCCAACTGCTCGAGTCCGAAGACAAGAAGCTCATTGGATACATTTCA
CGATCCGAAAACATCGTGAACCTGGTCAAGGTTATCTCCGACAAGAACATCGATTCGGATGAAGAAGATATAGAT
GATGGTGAGGGTGAAGTCATTACGCTCGCCCGTCGCTGCCTTGAGCTGGTTGGAGCTGGTCCTAAGCAGACCCTT
GTAGAAGCCTGA
Transcript >Pro_DTO377G3_2|g421.t1
ATGAGTGGAATCGCGAATGCCTGTCTGTCTTGCTTTTCAGCAGTGGACCAATGGTGTCATATCACAGCATGTCTC
GGTCCCATCGGAGCTCGTTCTCGAGATGGTATCTACGAAACAACCCTGGCCGATAATGAGCGAGAAGCGGTATCA
GATCTTCTAGGCTACTTGGAGAACCGCGCAGAGACCGACTTCTTCCACGGCGAGCCACTACGAGCCTTGAGTACC
CTTGTTTATTCCGAAAACGTCGACCTGCAAAGAAGCGCCAGCTTGACGTTTGCTGAGATCACAGAGCGAGATGTG
CGCGAGGTCGATCGCGATACCCTCGAACCTATCCTCTTTCTACTTCAAAGCTCAGATATCGAAGTTCAACGGGCT
GCTAGTGCAGCGCTGGGCAATCTCGCCGTAAATTCTGAGAACAAGGTCTTGATCGTCACCCTCGGGGGCCTATCT
CCCTTGATTCGCCAGATGATGTCGCCCAATGTCGAGGTACAGTGCAATGCGGTCGGATGTATAACCAATCTCGCG
ACCCATGAGGAGAACAAGGCCAAGATTGCTCGCTCTGGCGCTCTAGGTCCTCTCATTCGCCTGGCCAAGTCGAAG
GATATGCGTGTCCAGCGAAACGCGACGGGCGCACTGCTTAACATGACTCATTCGGATGACAACCGACAGCAACTT
GTCAATGCCGGCGCTATTCCCGTGCTCGTGCACCTCCTCTCATCCCCCGACGTTGACGTACAGTACTACTGCACA
ACAGCTCTCAGCAATATCGCCGTTGACTCGACGAATCGCAAACGACTCGCCCAAACCGAGTCACGCCTCGTGCAA
TCATTAGTTCACCTTATGGATTCATCCACTCCGAAAGTCCAATGTCAAGCGGCGCTCGCCCTGCGCAATCTCGCC
TCTGATGAGAAATACCAGCTTGAAATAGTTCGGGCGAAGGGCCTTTCTCCACTGCTACGACTCCTACAATCCTCC
TACCTTCCTCTCATCTTATCCGCCGTCGCTTGTATCCGCAACATTTCTATTCATCCTCTTAACGAATCCCCCATT
ATCGAAGCGGGCTTCTTGAAGCCGTTGGTGGATCTCCTAGGCTCGACTGACAACGAAGAGATTCAATGTCACGCT
ATATCCACGCTTCGTAACCTTGCTGCTAGCTCTGATCGCAACAAAGAACTTGTCCTGCAGGCCGGAGCAGTACAA
AAGTGCAAGGACTTGGTCTTGCGTGTTCCCCTAACAGTCCAATCTGAGATGACTGCTGCAATCGCTGTGCTGGCC
CTCAGCGAGGAGCTGAAGCCGCATCTTCTCAACCTCGGAGTGTTTGACGTCTTGATTCCTCTGACAAACTCTGAA
AGTATTGAGGTGCAAGGCAACAGCGCGGCTGCGTTGGGCAATCTGTCTTCGAAAGTCGGCGATTATTCGATGTTC
GTTCGCGACTGGGCAGACGCCAATGGTGGCATCCATGGCTACCTCCATCGCTTCCTTGCCAGTGGAGATCCCACA
TTCCAGCACATTGCCATCTGGACCCTCCTCCAACTGCTCGAGTCCGAAGACAAGAAGCTCATTGGATACATTTCA
CGATCCGAAAACATCGTGAACCTGGTCAAGGTTATCTCCGACAAGAACATCGATTCGGATGAAGAAGATATAGAT
GATGGTGAGGGTGAAGTCATTACGCTCGCCCGTCGCTGCCTTGAGCTGGTTGGAGCTGGTCCTAAGCAGACCCTT
GTAGAAGCCTGA
Gene >Pro_DTO377G3_2|g421.t1
ATGAGTGGAATCGCGAATGCCTGTCTGTCTTGCTTTTCAGCAGTGGACCAATGGTGTCATATCACAGCATGTCTC
GGTCCCATCGGAGCTCGTTCTCGAGATGGTATCTACGAAACAACCCTGGCCGATAATGAGCGAGAAGCGGTATCA
GATCTTCTAGGCTACTTGGAGAACGTACGTGCTCGACCGATTCATCATTCTGAACCACTATCTTCCCTTCTCTGA
AGCATAGCTGGAGACTGGGTTCGCCTGGGTACCGCCCTGCACCGAGCATACCGCTGACTTCCAATTGTACAGCGC
GCAGAGACCGACTTCTTCCACGGCGAGCCACTACGAGCCTTGAGTACCCTTGTTTATTCCGAAAACGTCGACCTG
CAAAGAAGCGCCAGCTTGACGTTTGCTGAGATCACAGAGCGAGGTGCGTATCGCCATCTTGCTAGCAATGATGCA
AGAGCTGACCTTCCGTCTTATCTACAGATGTGCGCGAGGTCGATCGCGATACCCTCGAACCTATCCTCTTTCTAC
TTCAAAGCTCAGATATCGAAGTTCAACGGGCTGCTAGTGCAGCGCTGGGCAATCTCGCCGTAAATTGTTGGTCAC
GTCCCCGTCCCGTCACCCATCACCCATCTCCTTTCCCGCTTCCCACACGGTCGCTAACTCGGTGCAGCTGAGAAC
AAGGTCTTGATCGTCACCCTCGGGGGCCTATCTCCCTTGATTCGCCAGATGATGTCGCCCAATGTCGAGGTACAG
TGCAATGCGGTCGGATGTATAACCAATCTCGCGACCCATGAGGAGAACAAGGCCAAGATTGCTCGCTCTGGCGCT
CTAGGTCCTCTCATTCGCCTGGCCAAGTCGAAGGATATGCGTGTCCAGCGAAACGCGACGGGCGCACTGCTTAAC
ATGACTCATTCGGGTAAGTGGCTCTAGTTGATTCGTCTGGCCGTTTCTCTAACATGAAGACCAGATGACAACCGA
CAGCAACTTGTCAATGCCGGCGCTATTCCCGTGCTCGTGCACCTCCTCTCATCCCCCGACGTTGACGTACAGTAC
TACTGCACAACAGCTCTCAGCAATATCGCCGTTGACTCGACGAATCGCAAACGACTCGCCCAAACCGAGTCACGC
CTCGTGCAATCATTAGTTCACCTTATGGATTCATCCACTCCGAAAGTCCAATGTCAAGCGGCGCTCGCCCTGCGC
AATCTCGCCTCTGATGAGAAATACCAGCTTGAAATAGTTCGGGCGAAGGGCCTTTCTCCACTGCTACGACTCCTA
CAATCCTCCTACCTTCCTCTCATCTTATCCGCCGTCGCTTGTATCCGCAACATTTCTATTCATCCTCTTAACGAA
TCCCCCATTATCGAAGCGGGCTTCTTGAAGCCGTTGGTGGATCTCCTAGGCTCGACTGACAACGAAGAGATTCAA
TGTCACGCTATATCCACGCTTCGTAACCTTGCTGCTAGCTCTGATCGCAACAAAGAACTTGTCCTGCAGGCCGGA
GCAGTACAAAAGTGCAAGGACTTGGTCTTGCGTGTTCCCCTAACAGTCCAATCTGAGATGACTGCTGCAATCGCT
GTGCTGGCCCTCAGCGAGGAGCTGAAGCCGCATCTTCTCAACCTCGGAGTGTTTGACGTCTTGATTCCTCTGACA
AACTCTGAAAGTATTGAGGTGCAAGGCAACAGCGCGGCTGCGTTGGGCAATCTGTCTTCGAAAGGTATTTCCCCT
TATATTTGTGTGTCCTTATAAGCTGCTAACAAATTCGTAGTCGGCGATTATTCGATGTTCGTTCGCGACTGGGCA
GACGCCAATGGTGGCATCCATGGCTACCTCCATCGCTTCCTTGCCAGTGGAGATCCCACATTCCAGCACATTGCC
ATCTGGACCCTCCTCCAACTGCTCGAGTCCGAAGACAAGAAGCTCATTGGATACATTTCACGATCCGAAAACATC
GTGAACCTGGTCAAGGTTATCTCCGACAAGAACATCGATTCGGATGAAGAAGATATAGATGATGGTGAGGGTGAA
GTCATTACGCTCGCCCGTCGCTGCCTTGAGCTGGTTGGAGCTGGTCCTAAGCAGACCCTTGTAGAAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail