Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4203.t1
Gene name
Locationscaffold_08:337257..338072
Strand+
Gene length (bp)815
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02656 DUF202 Domain of unknown function (DUF202) 3.9E-15 108 183

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 118 140 22
2 155 177 22
3 198 220 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4203.t1
MTEPGQTPIPEEPPNAILTDSHPTPARDARDDNLEALELHEIQTREDNELDYSTPSGSSGDENHVPTHRTTSQRD
SRRRREARKGLWSQICRFWTRNVSITVPQKSNRDHFALERTFLAYIRTSMVIAMQGVLVAQLFRLQRPLETVHRL
SFYHVGIPLAVACHAVAVIVALIGSFRFWRQQNAIARGKVYAGGWELNSVGILLFLVIVATLVLTVIILIETNLS
PSVLSNRISWP*
Coding >Pro_DTO377G3_2|g4203.t1
ATGACCGAGCCTGGCCAAACTCCTATTCCCGAGGAGCCACCTAACGCAATCCTGACCGACTCCCACCCGACTCCC
GCTCGCGACGCCCGCGATGACAACCTGGAAGCATTAGAGCTCCATGAGATCCAAACGCGAGAAGACAATGAGCTA
GACTACTCAACCCCATCAGGTTCATCTGGCGACGAGAACCACGTGCCCACACATCGAACTACGTCTCAACGGGAT
TCCCGGCGGAGACGCGAAGCCCGCAAGGGCCTTTGGAGCCAGATCTGTCGATTCTGGACTCGAAATGTTAGTATA
ACTGTGCCGCAGAAGAGCAATCGAGATCACTTTGCCCTGGAAAGGACGTTCCTTGCGTACATCCGCACGTCCATG
GTTATCGCTATGCAAGGGGTGCTTGTTGCTCAACTTTTCCGTCTACAACGGCCGTTGGAAACGGTCCATCGCCTG
TCATTCTACCATGTCGGTATCCCGCTTGCGGTTGCCTGTCATGCCGTGGCTGTTATCGTCGCCTTGATAGGTTCA
TTCCGATTCTGGAGACAACAAAATGCTATTGCTCGTGGCAAAGTTTATGCTGGGGGGTGGGAATTAAATTCAGTG
GGGATTTTACTATTCCTTGTCATTGTGGCGACTTTGGTACTTACCGTGATTATCTTGATTGAAACCAACTTGAGC
CCCAGTGTTCTTTCTAATCGAATATCATGGCCTTGA
Transcript >Pro_DTO377G3_2|g4203.t1
ATGACCGAGCCTGGCCAAACTCCTATTCCCGAGGAGCCACCTAACGCAATCCTGACCGACTCCCACCCGACTCCC
GCTCGCGACGCCCGCGATGACAACCTGGAAGCATTAGAGCTCCATGAGATCCAAACGCGAGAAGACAATGAGCTA
GACTACTCAACCCCATCAGGTTCATCTGGCGACGAGAACCACGTGCCCACACATCGAACTACGTCTCAACGGGAT
TCCCGGCGGAGACGCGAAGCCCGCAAGGGCCTTTGGAGCCAGATCTGTCGATTCTGGACTCGAAATGTTAGTATA
ACTGTGCCGCAGAAGAGCAATCGAGATCACTTTGCCCTGGAAAGGACGTTCCTTGCGTACATCCGCACGTCCATG
GTTATCGCTATGCAAGGGGTGCTTGTTGCTCAACTTTTCCGTCTACAACGGCCGTTGGAAACGGTCCATCGCCTG
TCATTCTACCATGTCGGTATCCCGCTTGCGGTTGCCTGTCATGCCGTGGCTGTTATCGTCGCCTTGATAGGTTCA
TTCCGATTCTGGAGACAACAAAATGCTATTGCTCGTGGCAAAGTTTATGCTGGGGGGTGGGAATTAAATTCAGTG
GGGATTTTACTATTCCTTGTCATTGTGGCGACTTTGGTACTTACCGTGATTATCTTGATTGAAACCAACTTGAGC
CCCAGTGTTCTTTCTAATCGAATATCATGGCCTTGA
Gene >Pro_DTO377G3_2|g4203.t1
ATGACCGAGCCTGGCCAAACTCCTATTCCCGAGGAGCCACCTAACGCAATCCTGACCGACTCCCACCCGACTCCC
GCTCGCGACGCCCGCGATGACAACCTGGAAGCATTAGAGCTCCATGAGATCCAAACGCGAGAAGACAATGAGCTA
GACTACTCAACCCCATCAGGTTCATCTGGCGACGAGAACCACGTGCCCACACATCGAACTACGTCTCAACGGGAT
TCCCGGCGGAGACGCGAAGCCCGCAAGGGCCTTTGGAGCCAGATCTGTCGATTCTGGACTCGAAATGTTAGTATA
ACTGTGCCGCAGAAGAGCAATCGAGATCACTTTGGTATGTTGTACTTTGGACACGCTGTTGGCACTCTAGTTGAC
ATGTTCAAAGCCCTGGAAAGGACGTTCCTTGCGTACATCCGCACGTCCATGGTTATCGCTATGCAAGGGGTGCTT
GTTGCTCAACTTTTCCGTCTACAACGGCCGTTGGAAACGGTCCATCGCCTGTCATTCTACCATGTCGGTATCCCG
CTTGCGGTTGCCTGTCATGCCGTGGCTGTTATCGTCGCCTTGATAGGTTCATTCCGATTCTGGAGACAACAAAAT
GCTATTGCTCGTGGCAAAGTTTATGCTGGGGGGTGGGAATTAAATTCAGTGGGGATTTTACTATTCCTTGTAAGT
CATCACTAGGACGATGCTCGGCCTCTGAATTCTAACCAACTCTACAGGTCATTGTGGCGACTTTGGTACTTACCG
TGATTATCTTGATTGAAACCAACTTGAGCCCCAGTGTTCTTTCTAATCGAATATCATGGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail