Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4202.t1
Gene name
Locationscaffold_08:333169..335722
Strand-
Gene length (bp)2553
Transcript length (bp)2553
Coding sequence length (bp)2553
Protein length (aa) 851

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01571 GCV_T Aminomethyltransferase folate-binding domain 3.4E-72 439 721
PF01266 DAO FAD dependent oxidoreductase 4.0E-46 6 377
PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain 7.4E-19 747 825
PF16350 FAO_M FAD dependent oxidoreductase central domain 1.5E-18 382 436

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4202.t1
MSLSQRVVIIGAGIVGTNLADELVSRGWKDITVVEQGPLHMPGGSTSHAPGLVFQTSPSKTMTYFARYTAEKLLS
IEKDGHKCFNQVGSLEIATTPARLEELKRKHGYASSWGIGARLLSAEECFKMYPHLNTDMVLGGLHVPTDGLALA
ARATQLLIERTSKAGVRYLGHTPVTGIERDGRRVTGVTTPKGTIPADIVVSCAGFWGVELGAMVGVEIPLLPLGH
QYAKTTAVPALEGRDVNSLPNGMNAALPILRHQDKRLYYREHGGQYGIGSYAHRPMPVVASSLGLTPKDVDEQNM
PSRLDFTTEDFDPAWKDSQELLPALRDTEIADGFNGIFSFTPDGGPILGQPSHLDGFYVAEAVWVTHSAGVARAL
AQILTTGRSDIDVSECELSRFEEIQLNRDYVSETAQQNFVEIYDIVHPLQPRTSPRNLRVSPFYPRQLELGAFFL
EVGGWERPWWYEANKDLVKSLPPSWQPVERDAWSAQFHSPISAAEAWKTRNAVAMFDMTAFHRFEVRGPGAIGLL
QRLTTSDMTTKIGTVTYTLLLNDHGGIRGDIFVLRLDDDVFQIGANTATDLAYLTREARVQEQGAPGKWTQVRDI
TGSTCCIGLWGPRSRDVIAGISTVDVSNKGLPYFTLKKTILAGIPVTMIRKSYVGELGWEIQTSAEYGQRLWDTI
WQAGKLHGLIAGGRSAFNSMRLEKGYRTYGADMTTEHNPFEAGVSFAVDANKKDDFVGKAAIQRLSNQVPSRRLR
ALTVDDGRSMILGKEPVFYNGKAAGYVTTAAFGYTIRKPIAYAWLPGGVGEGETVEIEYFGKRIKATVEAESLYD
PEMNRLSQDSLPSPIGSQGSFRSRL*
Coding >Pro_DTO377G3_2|g4202.t1
ATGTCCCTTTCACAACGTGTCGTCATCATTGGAGCGGGCATCGTGGGTACCAACCTCGCCGACGAGTTGGTCTCT
CGAGGATGGAAGGATATTACTGTTGTCGAGCAGGGCCCGTTGCATATGCCGGGCGGATCGACCTCACACGCCCCC
GGACTCGTATTCCAGACAAGCCCCTCCAAGACAATGACATACTTCGCACGATACACAGCCGAGAAGCTTCTTTCA
ATAGAGAAGGATGGACACAAATGCTTCAATCAGGTCGGCAGTCTCGAAATAGCAACAACTCCCGCACGACTGGAG
GAGCTGAAGCGGAAACATGGATATGCCTCATCATGGGGAATCGGGGCGCGGCTACTGAGCGCCGAGGAGTGCTTC
AAGATGTATCCTCATCTGAATACCGATATGGTGTTGGGCGGTCTGCACGTCCCGACCGATGGTCTCGCACTAGCA
GCCCGAGCAACGCAACTGCTGATTGAACGGACGAGCAAGGCCGGTGTTCGTTATCTGGGCCATACCCCCGTGACG
GGGATTGAGAGGGACGGTCGACGTGTCACCGGAGTCACTACTCCAAAGGGCACTATCCCCGCAGACATTGTTGTT
TCTTGCGCTGGGTTCTGGGGTGTTGAATTGGGAGCCATGGTCGGTGTGGAAATTCCTTTGCTCCCGCTGGGGCAC
CAGTATGCAAAGACTACGGCAGTACCTGCTCTCGAAGGACGAGATGTTAACAGCTTGCCCAATGGAATGAATGCC
GCACTACCAATCCTCCGGCACCAGGACAAGCGTCTTTACTACCGTGAACACGGCGGGCAGTACGGCATTGGATCC
TACGCACACCGTCCAATGCCCGTCGTTGCGTCATCATTGGGCCTTACTCCGAAAGATGTTGACGAACAAAACATG
CCTTCCCGCCTTGATTTCACAACCGAAGATTTCGACCCGGCTTGGAAAGATTCCCAAGAGCTTCTCCCCGCTCTA
AGGGACACAGAGATCGCAGATGGTTTCAATGGCATATTTTCCTTCACACCCGACGGTGGCCCAATCCTCGGCCAA
CCATCCCACCTCGACGGCTTCTACGTCGCCGAGGCCGTATGGGTTACACACTCAGCAGGCGTCGCCCGAGCTCTA
GCCCAAATACTTACAACCGGCCGATCGGATATCGACGTGTCTGAATGTGAGCTATCCCGCTTCGAAGAAATCCAA
CTCAATCGAGACTACGTGAGCGAGACCGCGCAGCAGAACTTCGTTGAAATATATGACATCGTCCACCCACTTCAG
CCGCGTACGTCGCCCCGCAATTTGCGTGTGAGTCCATTCTATCCTCGCCAGCTGGAGCTGGGGGCTTTCTTCCTC
GAGGTTGGAGGCTGGGAGCGGCCGTGGTGGTATGAGGCAAACAAAGATCTTGTCAAATCTCTCCCGCCATCATGG
CAACCTGTCGAACGAGATGCCTGGTCGGCGCAGTTCCATTCGCCGATCTCTGCCGCTGAAGCGTGGAAGACGCGG
AATGCTGTTGCTATGTTTGATATGACTGCTTTCCATCGGTTCGAGGTGCGCGGTCCCGGAGCAATCGGTCTGCTT
CAGCGCCTCACTACGAGTGACATGACCACCAAGATAGGAACCGTTACTTATACGCTCCTCCTGAATGATCACGGT
GGCATTCGGGGTGACATTTTTGTACTCCGACTTGACGACGATGTGTTCCAAATTGGAGCGAACACTGCAACAGAT
CTGGCGTATCTTACCAGAGAAGCTCGAGTCCAGGAACAAGGTGCCCCCGGGAAATGGACCCAGGTCCGCGATATC
ACAGGCAGCACATGCTGCATCGGACTGTGGGGTCCTCGATCCCGGGATGTTATCGCTGGAATCAGCACGGTCGAC
GTTTCCAACAAGGGACTTCCCTACTTCACTTTGAAGAAAACAATTCTCGCGGGTATCCCTGTTACAATGATCCGA
AAGTCCTATGTCGGCGAACTAGGTTGGGAAATCCAAACCAGCGCCGAGTATGGCCAGCGCCTATGGGACACAATT
TGGCAAGCTGGAAAGCTACACGGACTCATTGCTGGAGGTCGCAGTGCGTTCAACTCAATGCGCCTCGAGAAGGGA
TACCGGACCTACGGCGCGGATATGACGACAGAGCACAATCCGTTCGAGGCTGGTGTTTCATTTGCTGTCGATGCA
AATAAGAAAGATGACTTCGTCGGCAAAGCCGCTATTCAGCGCCTTTCCAACCAAGTACCTTCGCGGCGACTGCGG
GCTTTGACCGTTGATGATGGTCGGTCGATGATCCTTGGCAAGGAGCCGGTGTTCTATAATGGAAAGGCGGCTGGA
TATGTCACCACCGCTGCATTTGGATACACGATTCGCAAACCGATTGCCTACGCCTGGCTTCCTGGGGGTGTTGGT
GAAGGTGAGACAGTAGAGATCGAGTATTTTGGAAAGCGCATCAAGGCGACTGTTGAGGCAGAGTCGCTTTATGAT
CCCGAGATGAATCGTCTCAGTCAGGATAGCTTGCCTTCGCCGATTGGTTCACAAGGTTCATTCAGGTCACGACTT
TGA
Transcript >Pro_DTO377G3_2|g4202.t1
ATGTCCCTTTCACAACGTGTCGTCATCATTGGAGCGGGCATCGTGGGTACCAACCTCGCCGACGAGTTGGTCTCT
CGAGGATGGAAGGATATTACTGTTGTCGAGCAGGGCCCGTTGCATATGCCGGGCGGATCGACCTCACACGCCCCC
GGACTCGTATTCCAGACAAGCCCCTCCAAGACAATGACATACTTCGCACGATACACAGCCGAGAAGCTTCTTTCA
ATAGAGAAGGATGGACACAAATGCTTCAATCAGGTCGGCAGTCTCGAAATAGCAACAACTCCCGCACGACTGGAG
GAGCTGAAGCGGAAACATGGATATGCCTCATCATGGGGAATCGGGGCGCGGCTACTGAGCGCCGAGGAGTGCTTC
AAGATGTATCCTCATCTGAATACCGATATGGTGTTGGGCGGTCTGCACGTCCCGACCGATGGTCTCGCACTAGCA
GCCCGAGCAACGCAACTGCTGATTGAACGGACGAGCAAGGCCGGTGTTCGTTATCTGGGCCATACCCCCGTGACG
GGGATTGAGAGGGACGGTCGACGTGTCACCGGAGTCACTACTCCAAAGGGCACTATCCCCGCAGACATTGTTGTT
TCTTGCGCTGGGTTCTGGGGTGTTGAATTGGGAGCCATGGTCGGTGTGGAAATTCCTTTGCTCCCGCTGGGGCAC
CAGTATGCAAAGACTACGGCAGTACCTGCTCTCGAAGGACGAGATGTTAACAGCTTGCCCAATGGAATGAATGCC
GCACTACCAATCCTCCGGCACCAGGACAAGCGTCTTTACTACCGTGAACACGGCGGGCAGTACGGCATTGGATCC
TACGCACACCGTCCAATGCCCGTCGTTGCGTCATCATTGGGCCTTACTCCGAAAGATGTTGACGAACAAAACATG
CCTTCCCGCCTTGATTTCACAACCGAAGATTTCGACCCGGCTTGGAAAGATTCCCAAGAGCTTCTCCCCGCTCTA
AGGGACACAGAGATCGCAGATGGTTTCAATGGCATATTTTCCTTCACACCCGACGGTGGCCCAATCCTCGGCCAA
CCATCCCACCTCGACGGCTTCTACGTCGCCGAGGCCGTATGGGTTACACACTCAGCAGGCGTCGCCCGAGCTCTA
GCCCAAATACTTACAACCGGCCGATCGGATATCGACGTGTCTGAATGTGAGCTATCCCGCTTCGAAGAAATCCAA
CTCAATCGAGACTACGTGAGCGAGACCGCGCAGCAGAACTTCGTTGAAATATATGACATCGTCCACCCACTTCAG
CCGCGTACGTCGCCCCGCAATTTGCGTGTGAGTCCATTCTATCCTCGCCAGCTGGAGCTGGGGGCTTTCTTCCTC
GAGGTTGGAGGCTGGGAGCGGCCGTGGTGGTATGAGGCAAACAAAGATCTTGTCAAATCTCTCCCGCCATCATGG
CAACCTGTCGAACGAGATGCCTGGTCGGCGCAGTTCCATTCGCCGATCTCTGCCGCTGAAGCGTGGAAGACGCGG
AATGCTGTTGCTATGTTTGATATGACTGCTTTCCATCGGTTCGAGGTGCGCGGTCCCGGAGCAATCGGTCTGCTT
CAGCGCCTCACTACGAGTGACATGACCACCAAGATAGGAACCGTTACTTATACGCTCCTCCTGAATGATCACGGT
GGCATTCGGGGTGACATTTTTGTACTCCGACTTGACGACGATGTGTTCCAAATTGGAGCGAACACTGCAACAGAT
CTGGCGTATCTTACCAGAGAAGCTCGAGTCCAGGAACAAGGTGCCCCCGGGAAATGGACCCAGGTCCGCGATATC
ACAGGCAGCACATGCTGCATCGGACTGTGGGGTCCTCGATCCCGGGATGTTATCGCTGGAATCAGCACGGTCGAC
GTTTCCAACAAGGGACTTCCCTACTTCACTTTGAAGAAAACAATTCTCGCGGGTATCCCTGTTACAATGATCCGA
AAGTCCTATGTCGGCGAACTAGGTTGGGAAATCCAAACCAGCGCCGAGTATGGCCAGCGCCTATGGGACACAATT
TGGCAAGCTGGAAAGCTACACGGACTCATTGCTGGAGGTCGCAGTGCGTTCAACTCAATGCGCCTCGAGAAGGGA
TACCGGACCTACGGCGCGGATATGACGACAGAGCACAATCCGTTCGAGGCTGGTGTTTCATTTGCTGTCGATGCA
AATAAGAAAGATGACTTCGTCGGCAAAGCCGCTATTCAGCGCCTTTCCAACCAAGTACCTTCGCGGCGACTGCGG
GCTTTGACCGTTGATGATGGTCGGTCGATGATCCTTGGCAAGGAGCCGGTGTTCTATAATGGAAAGGCGGCTGGA
TATGTCACCACCGCTGCATTTGGATACACGATTCGCAAACCGATTGCCTACGCCTGGCTTCCTGGGGGTGTTGGT
GAAGGTGAGACAGTAGAGATCGAGTATTTTGGAAAGCGCATCAAGGCGACTGTTGAGGCAGAGTCGCTTTATGAT
CCCGAGATGAATCGTCTCAGTCAGGATAGCTTGCCTTCGCCGATTGGTTCACAAGGTTCATTCAGGTCACGACTT
TGA
Gene >Pro_DTO377G3_2|g4202.t1
ATGTCCCTTTCACAACGTGTCGTCATCATTGGAGCGGGCATCGTGGGTACCAACCTCGCCGACGAGTTGGTCTCT
CGAGGATGGAAGGATATTACTGTTGTCGAGCAGGGCCCGTTGCATATGCCGGGCGGATCGACCTCACACGCCCCC
GGACTCGTATTCCAGACAAGCCCCTCCAAGACAATGACATACTTCGCACGATACACAGCCGAGAAGCTTCTTTCA
ATAGAGAAGGATGGACACAAATGCTTCAATCAGGTCGGCAGTCTCGAAATAGCAACAACTCCCGCACGACTGGAG
GAGCTGAAGCGGAAACATGGATATGCCTCATCATGGGGAATCGGGGCGCGGCTACTGAGCGCCGAGGAGTGCTTC
AAGATGTATCCTCATCTGAATACCGATATGGTGTTGGGCGGTCTGCACGTCCCGACCGATGGTCTCGCACTAGCA
GCCCGAGCAACGCAACTGCTGATTGAACGGACGAGCAAGGCCGGTGTTCGTTATCTGGGCCATACCCCCGTGACG
GGGATTGAGAGGGACGGTCGACGTGTCACCGGAGTCACTACTCCAAAGGGCACTATCCCCGCAGACATTGTTGTT
TCTTGCGCTGGGTTCTGGGGTGTTGAATTGGGAGCCATGGTCGGTGTGGAAATTCCTTTGCTCCCGCTGGGGCAC
CAGTATGCAAAGACTACGGCAGTACCTGCTCTCGAAGGACGAGATGTTAACAGCTTGCCCAATGGAATGAATGCC
GCACTACCAATCCTCCGGCACCAGGACAAGCGTCTTTACTACCGTGAACACGGCGGGCAGTACGGCATTGGATCC
TACGCACACCGTCCAATGCCCGTCGTTGCGTCATCATTGGGCCTTACTCCGAAAGATGTTGACGAACAAAACATG
CCTTCCCGCCTTGATTTCACAACCGAAGATTTCGACCCGGCTTGGAAAGATTCCCAAGAGCTTCTCCCCGCTCTA
AGGGACACAGAGATCGCAGATGGTTTCAATGGCATATTTTCCTTCACACCCGACGGTGGCCCAATCCTCGGCCAA
CCATCCCACCTCGACGGCTTCTACGTCGCCGAGGCCGTATGGGTTACACACTCAGCAGGCGTCGCCCGAGCTCTA
GCCCAAATACTTACAACCGGCCGATCGGATATCGACGTGTCTGAATGTGAGCTATCCCGCTTCGAAGAAATCCAA
CTCAATCGAGACTACGTGAGCGAGACCGCGCAGCAGAACTTCGTTGAAATATATGACATCGTCCACCCACTTCAG
CCGCGTACGTCGCCCCGCAATTTGCGTGTGAGTCCATTCTATCCTCGCCAGCTGGAGCTGGGGGCTTTCTTCCTC
GAGGTTGGAGGCTGGGAGCGGCCGTGGTGGTATGAGGCAAACAAAGATCTTGTCAAATCTCTCCCGCCATCATGG
CAACCTGTCGAACGAGATGCCTGGTCGGCGCAGTTCCATTCGCCGATCTCTGCCGCTGAAGCGTGGAAGACGCGG
AATGCTGTTGCTATGTTTGATATGACTGCTTTCCATCGGTTCGAGGTGCGCGGTCCCGGAGCAATCGGTCTGCTT
CAGCGCCTCACTACGAGTGACATGACCACCAAGATAGGAACCGTTACTTATACGCTCCTCCTGAATGATCACGGT
GGCATTCGGGGTGACATTTTTGTACTCCGACTTGACGACGATGTGTTCCAAATTGGAGCGAACACTGCAACAGAT
CTGGCGTATCTTACCAGAGAAGCTCGAGTCCAGGAACAAGGTGCCCCCGGGAAATGGACCCAGGTCCGCGATATC
ACAGGCAGCACATGCTGCATCGGACTGTGGGGTCCTCGATCCCGGGATGTTATCGCTGGAATCAGCACGGTCGAC
GTTTCCAACAAGGGACTTCCCTACTTCACTTTGAAGAAAACAATTCTCGCGGGTATCCCTGTTACAATGATCCGA
AAGTCCTATGTCGGCGAACTAGGTTGGGAAATCCAAACCAGCGCCGAGTATGGCCAGCGCCTATGGGACACAATT
TGGCAAGCTGGAAAGCTACACGGACTCATTGCTGGAGGTCGCAGTGCGTTCAACTCAATGCGCCTCGAGAAGGGA
TACCGGACCTACGGCGCGGATATGACGACAGAGCACAATCCGTTCGAGGCTGGTGTTTCATTTGCTGTCGATGCA
AATAAGAAAGATGACTTCGTCGGCAAAGCCGCTATTCAGCGCCTTTCCAACCAAGTACCTTCGCGGCGACTGCGG
GCTTTGACCGTTGATGATGGTCGGTCGATGATCCTTGGCAAGGAGCCGGTGTTCTATAATGGAAAGGCGGCTGGA
TATGTCACCACCGCTGCATTTGGATACACGATTCGCAAACCGATTGCCTACGCCTGGCTTCCTGGGGGTGTTGGT
GAAGGTGAGACAGTAGAGATCGAGTATTTTGGAAAGCGCATCAAGGCGACTGTTGAGGCAGAGTCGCTTTATGAT
CCCGAGATGAATCGTCTCAGTCAGGATAGCTTGCCTTCGCCGATTGGTTCACAAGGTTCATTCAGGTCACGACTT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail