Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g42.t1
Gene name
Locationscaffold_01:100954..102757
Strand+
Gene length (bp)1803
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17433 Glyco_hydro_49N Glycosyl hydrolase family 49 N-terminal Ig-like domain 3.9E-72 30 221
PF03718 Glyco_hydro_49 Glycosyl hydrolase family 49 4.5E-23 487 598
PF18841 B_solenoid_dext Beta solenoid repeat from Dextranase 7.8E-14 361 396
PF18783 IPU_b_solenoid Isopullulanase beta-solenoid repeat 9.7E-13 432 464

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g42.t1
MITLKSFLLPAIGLQTLAGAFVLPRETDSTPNTHCGSDFCTWWHDTAEINTATAVEAGNVRQSHQYLVQVAAAGS
NTSYDSFVYESIPRNGNGKIQTPGDTSDTFSGDDGISIEIDAGINMAWSQFEYSEDVDVTISRRDGQDVGMDLII
RPSTIAYELSYADNAVIIRVPADENGRKFSVEFGNDLYTFRSDGEAYTTDGSGEVVGIEPINALLIFASPFLSSD
LIPASDGADTVVMTPGAFTANDIGSASIVYFPPGVYYIDSDPLGEAHIKLDPNTYWVYLAPGAYVKGGIEYTTTA
QDFYATGHGVLSGEIYVYQANVDQGYTAVKDDVTSLRMWWHRSVTSGQIWHCVGPTLTSPPFNTMDLMDGSSDRD
DISVDIYDYKQVGAFFMQTDGPQMYTNGSVHDVFYHVNDDAIKTYYSGVTASRLTVWKAFNDPIIQMGWTPREVS
GVTIDTLNIIHSRYRKSENGVPSAIIGASPNYDGSDNVDSSKSISMSISNVYCEGPCPGLFRLTPLQNYKNFSVK
GVSFPDGLIGGSVPVGDTIIASTSDTTYDGSTSLSMELDISGWTVQGQAVTGDNADSLGQFNINSAYSGQWSISS
*
Coding >Pro_DTO377G3_2|g42.t1
ATGATTACTCTCAAATCTTTTCTACTCCCTGCTATCGGGCTGCAAACCCTAGCTGGGGCGTTTGTTCTACCCCGA
GAAACGGATTCTACCCCCAATACACACTGTGGCTCGGATTTCTGTACCTGGTGGCACGACACGGCCGAGATAAAC
ACAGCCACTGCTGTCGAAGCAGGCAATGTCCGGCAATCTCACCAATATCTCGTTCAGGTTGCCGCTGCTGGGTCG
AACACCTCATACGATTCCTTCGTCTACGAAAGCATTCCTCGCAATGGCAACGGAAAAATCCAGACCCCCGGAGAT
ACCAGCGACACATTCAGCGGCGACGATGGAATTTCAATTGAGATTGATGCTGGCATCAATATGGCGTGGTCCCAG
TTTGAATATAGTGAGGATGTCGATGTCACCATTTCCCGCAGAGACGGTCAGGATGTTGGCATGGACCTTATCATT
CGGCCGAGTACCATTGCGTATGAACTCAGTTACGCGGACAATGCAGTGATCATCCGTGTCCCTGCTGATGAAAAC
GGACGCAAGTTTTCCGTGGAGTTCGGCAACGACCTTTACACCTTCCGGTCTGATGGAGAAGCTTATACCACCGAC
GGATCAGGGGAAGTCGTTGGGATTGAACCCATCAACGCTCTGCTCATCTTCGCCAGCCCATTCCTCTCAAGTGAT
CTTATCCCAGCCAGCGATGGTGCCGACACCGTGGTGATGACACCTGGTGCATTCACCGCAAATGACATTGGCTCG
GCATCTATTGTCTACTTCCCGCCCGGCGTGTACTATATCGACTCGGACCCTCTGGGTGAAGCTCACATCAAGCTC
GATCCTAACACCTACTGGGTGTACCTTGCCCCTGGAGCGTATGTGAAAGGAGGAATCGAATACACCACTACAGCC
CAGGACTTTTACGCCACAGGCCACGGTGTTTTGTCTGGGGAAATCTACGTCTACCAAGCAAACGTGGACCAAGGC
TACACAGCAGTCAAAGATGACGTGACTAGTCTTCGAATGTGGTGGCACCGGAGCGTCACAAGCGGCCAAATCTGG
CACTGTGTCGGACCGACTCTGACTTCGCCCCCGTTCAACACCATGGATTTGATGGATGGAAGTTCCGACCGAGAC
GACATCTCGGTTGATATCTACGATTACAAGCAGGTCGGGGCCTTCTTCATGCAGACTGATGGCCCTCAGATGTAC
ACCAATGGCAGTGTGCACGATGTCTTCTACCATGTGAACGATGACGCTATCAAGACGTATTATTCTGGAGTCACT
GCATCCCGGCTCACAGTGTGGAAGGCCTTCAACGATCCGATCATCCAGATGGGCTGGACACCTCGCGAAGTTTCC
GGCGTTACCATCGATACACTCAATATCATCCACTCACGCTATCGCAAGAGCGAGAACGGTGTTCCTTCGGCCATT
ATTGGTGCTTCGCCAAACTACGACGGCAGCGACAATGTTGATAGCTCCAAGTCAATCAGCATGAGCATTTCCAAC
GTCTACTGCGAGGGTCCTTGCCCTGGCCTTTTCCGTCTCACTCCTCTGCAGAACTATAAGAACTTCAGTGTAAAG
GGAGTATCCTTCCCAGATGGACTGATCGGTGGCAGTGTCCCCGTCGGAGACACCATCATTGCTTCTACAAGTGAT
ACCACTTACGATGGATCGACTAGTCTCTCCATGGAGCTGGACATTTCGGGATGGACCGTCCAAGGGCAAGCAGTG
ACTGGAGACAATGCAGACTCTTTGGGTCAATTCAACATCAATAGTGCCTACTCTGGACAGTGGTCAATTTCTTCT
TGA
Transcript >Pro_DTO377G3_2|g42.t1
ATGATTACTCTCAAATCTTTTCTACTCCCTGCTATCGGGCTGCAAACCCTAGCTGGGGCGTTTGTTCTACCCCGA
GAAACGGATTCTACCCCCAATACACACTGTGGCTCGGATTTCTGTACCTGGTGGCACGACACGGCCGAGATAAAC
ACAGCCACTGCTGTCGAAGCAGGCAATGTCCGGCAATCTCACCAATATCTCGTTCAGGTTGCCGCTGCTGGGTCG
AACACCTCATACGATTCCTTCGTCTACGAAAGCATTCCTCGCAATGGCAACGGAAAAATCCAGACCCCCGGAGAT
ACCAGCGACACATTCAGCGGCGACGATGGAATTTCAATTGAGATTGATGCTGGCATCAATATGGCGTGGTCCCAG
TTTGAATATAGTGAGGATGTCGATGTCACCATTTCCCGCAGAGACGGTCAGGATGTTGGCATGGACCTTATCATT
CGGCCGAGTACCATTGCGTATGAACTCAGTTACGCGGACAATGCAGTGATCATCCGTGTCCCTGCTGATGAAAAC
GGACGCAAGTTTTCCGTGGAGTTCGGCAACGACCTTTACACCTTCCGGTCTGATGGAGAAGCTTATACCACCGAC
GGATCAGGGGAAGTCGTTGGGATTGAACCCATCAACGCTCTGCTCATCTTCGCCAGCCCATTCCTCTCAAGTGAT
CTTATCCCAGCCAGCGATGGTGCCGACACCGTGGTGATGACACCTGGTGCATTCACCGCAAATGACATTGGCTCG
GCATCTATTGTCTACTTCCCGCCCGGCGTGTACTATATCGACTCGGACCCTCTGGGTGAAGCTCACATCAAGCTC
GATCCTAACACCTACTGGGTGTACCTTGCCCCTGGAGCGTATGTGAAAGGAGGAATCGAATACACCACTACAGCC
CAGGACTTTTACGCCACAGGCCACGGTGTTTTGTCTGGGGAAATCTACGTCTACCAAGCAAACGTGGACCAAGGC
TACACAGCAGTCAAAGATGACGTGACTAGTCTTCGAATGTGGTGGCACCGGAGCGTCACAAGCGGCCAAATCTGG
CACTGTGTCGGACCGACTCTGACTTCGCCCCCGTTCAACACCATGGATTTGATGGATGGAAGTTCCGACCGAGAC
GACATCTCGGTTGATATCTACGATTACAAGCAGGTCGGGGCCTTCTTCATGCAGACTGATGGCCCTCAGATGTAC
ACCAATGGCAGTGTGCACGATGTCTTCTACCATGTGAACGATGACGCTATCAAGACGTATTATTCTGGAGTCACT
GCATCCCGGCTCACAGTGTGGAAGGCCTTCAACGATCCGATCATCCAGATGGGCTGGACACCTCGCGAAGTTTCC
GGCGTTACCATCGATACACTCAATATCATCCACTCACGCTATCGCAAGAGCGAGAACGGTGTTCCTTCGGCCATT
ATTGGTGCTTCGCCAAACTACGACGGCAGCGACAATGTTGATAGCTCCAAGTCAATCAGCATGAGCATTTCCAAC
GTCTACTGCGAGGGTCCTTGCCCTGGCCTTTTCCGTCTCACTCCTCTGCAGAACTATAAGAACTTCAGTGTAAAG
GGAGTATCCTTCCCAGATGGACTGATCGGTGGCAGTGTCCCCGTCGGAGACACCATCATTGCTTCTACAAGTGAT
ACCACTTACGATGGATCGACTAGTCTCTCCATGGAGCTGGACATTTCGGGATGGACCGTCCAAGGGCAAGCAGTG
ACTGGAGACAATGCAGACTCTTTGGGTCAATTCAACATCAATAGTGCCTACTCTGGACAGTGGTCAATTTCTTCT
TGA
Gene >Pro_DTO377G3_2|g42.t1
ATGATTACTCTCAAATCTTTTCTACTCCCTGCTATCGGGCTGCAAACCCTAGCTGGGGCGTTTGTTCTACCCCGA
GAAACGGATTCTACCCCCAATACACACTGTGGCTCGGATTTCTGTACCTGGTGGCACGACACGGCCGAGATAAAC
ACAGCCACTGCTGTCGAAGCAGGCAATGTCCGGCAATCTCACCAATATCTCGTTCAGGTTGCCGCTGCTGGGTCG
AACACCTCATACGATTCCTTCGTCTACGAAAGCATTCCTCGCAATGGCAACGGAAAAATCCAGACCCCCGGAGAT
ACCAGCGACACATTCAGCGGCGACGATGGAATTTCAATTGAGATTGATGCTGGCATCAATATGGCGTGGTCCCAG
TTTGAATATAGTGAGGATGTCGATGTCACCATTTCCCGCAGAGACGGTCAGGATGTTGGCATGGACCTTATCATT
CGGCCGAGTACCATTGCGTATGAACTCAGTTACGCGGACAATGCAGTGATCATCCGTGTCCCTGCTGATGAAAAC
GGACGCAAGTTTTCCGTGGAGTTCGGCAACGACCTTTACACCTTCCGGTCTGATGGAGAAGCTTATACCACCGAC
GGATCAGGGGAAGTCGTTGGGATTGAACCCATCAACGCTCTGCTCATCTTCGCCAGCCCATTCCTCTCAAGTGAT
CTTATCCCAGCCAGCGATGGTGCCGACACCGTGGTGATGACACCTGGTGCATTCACCGCAAATGACATTGGCTCG
GCATCTATTGTCTACTTCCCGCCCGGCGTGTACTATATCGACTCGGACCCTCTGGGTGAAGCTCACATCAAGCTC
GATCCTAACACCTACTGGGTGTACCTTGCCCCTGGAGCGTATGTGAAAGGAGGAATCGAATACACCACTACAGCC
CAGGACTTTTACGCCACAGGCCACGGTGTTTTGTCTGGGGAAATCTACGTCTACCAAGCAAACGTGGACCAAGGC
TACACAGCAGTCAAAGATGACGTGACTAGTCTTCGAATGTGGTGGCACCGGAGCGTCACAAGCGGCCAAATCTGG
CACTGTGTCGGACCGACTCTGACTTCGCCCCCGTTCAACACCATGGATTTGATGGATGGAAGTTCCGACCGAGAC
GACATCTCGGTTGATATCTACGATTACAAGCAGGTCGGGGCCTTCTTCATGCAGACTGATGGCCCTCAGATGTAC
ACCAATGGCAGTGTGCACGATGTCTTCTACCATGTGAACGATGACGCTATCAAGACGTATTATTCTGGAGTCACT
GCATCCCGGCTCACAGTGTGGAAGGCCTTCAACGATCCGATCATCCAGATGGGCTGGACACCTCGCGAAGTTTCC
GGCGTTACCATCGATACACTCAATATCATCCACTCACGCTATCGCAAGAGCGAGAACGGTGTTCCTTCGGCCATT
ATTGGTGCTTCGCCAAACTACGACGGCAGCGACAATGTTGATAGCTCCAAGTCAATCAGCATGAGCATTTCCAAC
GTCTACTGCGAGGGTCCTTGCCCTGGCCTTTTCCGTCTCACTCCTCTGCAGAACTATAAGAACTTCAGTGTAAAG
GGAGTATCCTTCCCAGATGGACTGATCGGTGGCAGTGTCCCCGTCGGAGACACCATCATTGCTTCTACAAGTGAT
ACCACTTACGATGGATCGACTAGTCTCTCCATGGAGCTGGACATTTCGGGATGGACCGTCCAAGGGCAAGCAGTG
ACTGGAGACAATGCAGACTCTTTGGGTCAATTCAACATCAATAGTGCCTACTCTGGACAGTGGTCAATTTCTTCT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail