Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4183.t1
Gene name
Locationscaffold_08:280619..288790
Strand+
Gene length (bp)8171
Transcript length (bp)7878
Coding sequence length (bp)7878
Protein length (aa) 2626

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 3.7E-65 22 271
PF14765 PS-DH Polyketide synthase dehydratase 9.1E-63 1014 1332
PF08659 KR KR domain 1.1E-59 2253 2430
PF00698 Acyl_transf_1 Acyl transferase domain 1.1E-43 620 950
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 3.7E-33 281 394
PF08242 Methyltransf_12 Methyltransferase domain 4.8E-19 1523 1631
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 8.9E-10 399 486
PF13649 Methyltransf_25 Methyltransferase domain 5.7E-10 1522 1629
PF13847 Methyltransf_31 Methyltransferase domain 3.7E-10 1517 1636
PF00106 adh_short short chain dehydrogenase 7.6E-10 2257 2403
PF13489 Methyltransf_23 Methyltransferase domain 3.9E-10 1516 1685
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.2E-09 2058 2152
PF08241 Methyltransf_11 Methyltransferase domain 7.5E-08 1523 1633
PF00550 PP-binding Phosphopantetheine attachment site 4.1E-06 2550 2612
PF05401 NodS Nodulation protein S (NodS) 2.7E-05 1508 1633

GO

GO Term Description Terminal node
GO:0009312 oligosaccharide biosynthetic process Yes
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008168 methyltransferase activity Yes
GO:0009877 nodulation Yes
GO:0016051 carbohydrate biosynthetic process No
GO:0005975 carbohydrate metabolic process No
GO:0044403 symbiont process No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0044419 interspecies interaction between organisms No
GO:0044238 primary metabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0051704 multi-organism process No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4183.t1
MRPLSLKTGSSGDGAMPSDALEPIAIIGLATHFPKQATTTEGLWELLLQARSTWSSIPKERFNSDAFYHPDPEHG
GTFHVQGGHYLSEDPAYFDGSFFNITKNELLTLDPQQRLVLENVYHALENAGIPLTSAVGSNTSVFVSGFNHDYL
GILNSDPETTLKYKPTGVTNAILSNRVSWFFDFRGPSMTIDTACSSSLVALHLAVQSLRANETIMAVVSGVSILE
NPAETIGMSHHGLLGPQGRSFSFDSRAEGYARGEGVGTVVVKPLSVAIRDGDTIRAVIRETGVNQDGRTPGITVP
SADAQERLIREVYWRAGLDLEHTRFVEAHGTGTSTGDPIEAGALARAFKCRRETPLYVGAIKSSIGHLEGGSGVA
SLIKSILILESGIIPANFDMKQTNSSIPATEYDIAFPTEALPWPSPGLRRVSVNSFGIGGTNAHCILDDAYHYLN
DHRLTGAHRTTSTVPTTQKINSRLLALCRTGTESNHFVTDSFDDSDHSGHGNTFMDTPTSDGFCESPTFASSTYT
SLIEKPKLFLLSAFDEDGVKRNAAELAKYLNRRMMKSVLHDYLLDDLSFTLSKKRSHFPWRSFVMASSVKELAWN
LSEANFAKPIRTARVPEVEFVFTGQGAQYQAMGRELMVYPVFQESVEEASDYIRRLGSPWSLLDELLTERQSPRV
NLPEIAHPLCTVLQIALVDLLTSWGIFPKRVTGHSSGEIAAAYCSGKLSREGSWKVAYYRGYVSSKQLSANGAMM
AVGLDASQLQPYLDSVRKDNAGELIIACRNSPKNNTVSGDEAMIDCLKSLLDADAIFARKLNVKNAYHSAHMHAI
AQDYLSLMGMLSFGRRLAAPHQVHMFSTVTGQQVQEEHLPAQYWVDNMVSPVLFTSGLVAMTSNQISSHDSIDST
DSLRLIVEIGPHTTLQSAIKETLASKSPKLEFKYLAVLKRTDHSLNTLLTTVGFLGSSGCELDLHAVNQGSCFKA
RRRPRLLVDLPPYSFKHTEKILFESRLSKNLRTRKFPRHDLFGAPITDWNPTAPRWRHFVRLNENPWLRDHVVTG
NYVYPGVGYLIMAIEASRQLVGEAKIIGFQLRKVNIRRALIVPDTKEGIEVSLAMATVEDSSSSRTWRRFQITSY
NASSDQWTEHCTGYITVDHETAFDPIDNGREAEEESRALESELFRANETCAKSMAFKSTYNNLQTSGLNFGPLFR
NLGDVRASACGLGKVVGSVTVPDIAQSMPKQYLHSHLIHPATMDSMIHLMIAAVLDFTGKSTLDQIRLPTFIRNV
WVSADLNSAPAHKFTGHATVSMVGSDKFEGQIQMLDEETNTLRIRMDGIELTPLESGLAESSERKLCSAIEFKPD
LHFIDSKSACALTSLNATDDTEALYWVKRLQLATMLYVMDALDELKDIDAMKLDLHMRRFFDWMEHMQGLLERNE
IIHLPYSEFQCAFQDEALKEAIGKEIEAHSAEGAITARMGRNIAQVVLQETDPLHLMFGQDAVMEQVYKEGLHLY
NLPQHLQSHLSLLRHQHSELNILEIGGGTGSFTAEVLAVLSPDLAKDKGSIASYTFTDISSGFFEKAKQRFQAWS
DIMNFQSLNIERSPVDQGLQLGTYDLIFAGNVIHATANLQNALQNLRSLLKPGGQLIMQEGIRQDFLWYPLVFGQ
LPGWWLGDEPCRQWCPYIPAEEWNPVLLKAGFSGIDVEYPSSNDPDLTWQSILVSSAIETPKEKSSNTAVILTFG
TLRSEQVIKDLQGLLPELGYTNILVKEPADVKNYILPDALFVSLMDLESPYLFDMDEAEYHTLKKMLSECQNLLW
VTCNPLIQPHASMSIGLLRTVRWERDADGSNIVTLTEAEPDITSPKSLATAIGKIVQRQFVDNPENDRHAEYMLQ
NDLIHIGRLNEWEAADQFLAAQSSQQAPPQLQRLGDYDHPIELQETAVSTSEYHWVIDKEHETPQKDTEVEIEIR
AIGLSSNVYADRLANEVAGVVTKVGPEVEGPAPGDRVIYISGDKKGGCIRTHGRADQMQLVKIPDEISFEVAAGL
AWAYATAIQGLGEIAHLAPENTILIHTSVTDISQAAIQYAQMIGATIYATVATVEERDLLVSNYGISQDRIFSRR
DLSFIKGIMRCTNNTGVDVVFNALSGEALRGSTACLAPFGAFVHVSNLDLRADTTIELASLPRNVSVYTVDIPLL
AQHRPKSVRLLLIEALRLYSAKRIGQLHTTVMDFTRIKEGIQTAHSGEAAKVVITPDPSNMVPMVPRPLQPCHFD
PRASYVLAGGYGGLGRSLARCMASRGAKSLIILSRSSASSSEKMELIGDLDRMGCKVHSLICDVADLSNLQQLSR
AAFSNLPAIKGCIQASMVLRDGAFAGLSFDDWKAAIRPKVQGSWNLHTVLPDSMDFFIMLSSVAGIFGNRGQSNY
AAGNTFQDALAAYRVSKGMHAASINLGSVSNVGWVAENRNSMRTHTATLFELLREEEVHATVDFLIRDQQDGGNA
SPRSQLILGLPTAEMCRQNGVPLPTYLNYSMFTHFRNTATAKSSEVSLQKTVSTAALLSAASGFESAVVVVSDGI
VERLASLLAIPCSELDAQRFSFGGIDSLVAMEFRAWIIKELKAEVSLLDIMGAENIRALSEKIAGRSRLIGGSGA
*
Coding >Pro_DTO377G3_2|g4183.t1
ATGCGTCCCCTCTCGCTGAAGACAGGCTCCAGTGGCGATGGAGCCATGCCTTCTGATGCTCTGGAACCCATCGCT
ATCATTGGCCTAGCCACCCACTTTCCAAAGCAAGCAACAACCACTGAGGGTCTGTGGGAGCTTCTCCTACAGGCC
CGCTCGACGTGGTCATCGATACCCAAAGAACGCTTCAACTCAGATGCCTTCTATCATCCAGATCCCGAGCATGGT
GGAACGTTTCATGTCCAAGGAGGTCACTACCTCTCAGAAGACCCCGCCTACTTCGATGGCTCCTTCTTCAATATT
ACCAAGAATGAGCTCCTGACATTGGATCCGCAGCAGCGGCTGGTACTCGAAAATGTCTACCATGCCTTGGAAAAT
GCTGGCATTCCATTGACCAGTGCTGTTGGCTCTAACACATCGGTTTTTGTTAGTGGATTCAACCATGACTACCTA
GGTATCCTCAATTCAGACCCAGAAACCACTTTGAAATACAAACCCACCGGTGTCACCAATGCCATTCTGTCTAAC
CGTGTCAGTTGGTTCTTTGACTTCAGAGGACCCAGCATGACCATTGATACGGCTTGTTCTAGTAGCTTGGTGGCA
CTGCACCTCGCTGTACAGAGCTTACGTGCCAATGAGACAATTATGGCTGTCGTCAGTGGTGTGAGCATTCTTGAA
AACCCCGCGGAAACCATCGGCATGAGTCACCATGGTTTGTTGGGACCTCAAGGGCGATCTTTCAGCTTCGACTCC
CGTGCCGAAGGCTATGCGCGAGGCGAAGGCGTGGGCACAGTTGTAGTGAAGCCTTTGAGTGTCGCTATCAGAGAT
GGAGATACCATCCGTGCGGTCATTCGAGAGACGGGAGTCAACCAGGATGGCCGCACGCCAGGGATTACAGTTCCT
AGCGCAGATGCCCAAGAAAGACTAATCCGTGAGGTCTACTGGAGAGCCGGCCTGGACCTCGAACACACAAGATTC
GTTGAAGCCCATGGCACTGGAACAAGCACCGGTGACCCTATCGAAGCGGGCGCTCTTGCAAGAGCATTCAAATGT
CGCCGAGAGACTCCGCTTTACGTCGGGGCGATCAAATCTTCCATTGGGCATCTGGAAGGTGGCTCAGGTGTGGCA
AGCCTCATCAAATCTATTCTAATACTTGAGTCTGGGATTATACCTGCAAACTTTGATATGAAGCAGACAAATTCC
TCTATTCCTGCAACTGAGTACGATATTGCATTCCCTACCGAGGCTCTTCCATGGCCATCTCCGGGCCTGCGAAGA
GTGTCAGTCAACTCATTTGGAATTGGTGGCACCAATGCTCACTGCATCCTTGATGACGCCTACCACTATCTGAAT
GACCACCGCCTTACAGGCGCCCACCGCACCACATCCACTGTTCCTACAACACAGAAAATCAACAGCCGGCTCTTG
GCCCTGTGTCGAACAGGAACGGAATCAAACCATTTCGTGACGGATTCATTCGATGACAGCGATCACTCTGGACAT
GGTAATACCTTTATGGACACACCCACAAGCGATGGCTTTTGTGAATCACCAACATTCGCATCATCCACATACACT
AGCTTGATCGAAAAACCAAAGCTGTTCTTACTCTCGGCTTTTGACGAAGATGGCGTCAAGCGGAACGCAGCTGAA
TTAGCCAAGTACTTGAACCGAAGAATGATGAAGTCAGTCCTCCATGACTATCTCCTTGATGACCTGTCCTTCACC
CTGTCGAAGAAACGATCCCATTTTCCCTGGAGGAGCTTCGTCATGGCATCCTCAGTCAAAGAACTCGCATGGAAC
CTGTCAGAAGCGAATTTTGCCAAGCCAATTAGAACTGCCAGAGTTCCGGAGGTTGAATTTGTTTTCACTGGCCAA
GGAGCTCAGTATCAGGCTATGGGCCGAGAGCTCATGGTCTATCCTGTATTTCAAGAGTCCGTGGAGGAAGCATCG
GACTATATCCGGCGGCTCGGTAGTCCGTGGTCGCTACTTGACGAACTCTTGACTGAAAGACAGTCACCCCGAGTC
AACTTGCCTGAGATAGCTCATCCGCTGTGCACAGTCTTGCAAATTGCGCTCGTGGATCTTCTGACCAGTTGGGGA
ATCTTCCCAAAACGTGTAACGGGTCACTCATCCGGCGAGATAGCCGCCGCTTACTGCTCTGGCAAGCTATCCCGC
GAAGGTTCTTGGAAGGTTGCATACTATCGTGGATACGTATCATCCAAACAGCTTTCCGCAAATGGAGCTATGATG
GCCGTGGGCCTGGATGCATCGCAACTGCAACCTTATCTGGACTCTGTGAGGAAGGACAACGCCGGGGAGCTCATC
ATCGCCTGCCGCAACAGTCCCAAAAACAACACCGTTTCTGGAGACGAAGCTATGATCGACTGCCTCAAGAGTCTT
CTCGATGCTGATGCCATCTTTGCTCGAAAGTTGAACGTCAAGAATGCTTATCACTCGGCCCACATGCATGCGATC
GCTCAGGATTACCTTAGTCTAATGGGAATGCTTTCTTTTGGAAGGCGGCTGGCAGCTCCACATCAAGTGCATATG
TTTTCCACCGTCACAGGACAACAAGTCCAAGAGGAACACCTGCCTGCACAATACTGGGTGGACAATATGGTTTCT
CCTGTTCTTTTCACAAGCGGGTTGGTTGCAATGACCTCAAACCAAATTTCCAGTCATGACTCGATTGATTCCACG
GATTCTCTGCGCCTTATCGTGGAAATAGGGCCTCACACAACCCTTCAGAGTGCCATCAAAGAGACATTGGCCTCG
AAGAGCCCCAAGTTGGAATTTAAGTACCTAGCCGTTCTCAAACGGACAGATCACAGCCTCAACACTCTACTAACT
ACAGTCGGCTTCCTAGGTTCAAGTGGATGTGAACTAGATCTTCATGCTGTGAACCAAGGTTCTTGCTTCAAGGCA
AGAAGACGGCCCAGACTGTTGGTGGACCTGCCGCCATACAGCTTCAAACATACCGAGAAGATTTTATTTGAGTCT
CGACTGAGCAAGAATCTGCGAACTCGAAAGTTCCCTCGTCATGACCTCTTCGGTGCACCTATCACGGATTGGAAT
CCTACAGCCCCAAGATGGAGACATTTTGTCCGATTGAACGAAAACCCTTGGTTAAGGGATCATGTGGTCACTGGA
AACTATGTCTATCCTGGTGTGGGTTATTTGATCATGGCAATTGAAGCATCGAGGCAGTTGGTCGGCGAGGCAAAG
ATCATTGGTTTCCAACTACGAAAAGTCAACATCCGAAGAGCCTTGATTGTACCCGATACCAAAGAAGGAATTGAG
GTTTCCTTGGCAATGGCAACTGTCGAAGACTCGTCATCGTCGCGAACGTGGAGGCGATTCCAGATAACTTCCTAC
AATGCATCGAGCGACCAGTGGACAGAACATTGCACTGGTTACATCACCGTCGACCACGAAACAGCTTTCGATCCA
ATTGACAATGGCCGCGAAGCAGAAGAAGAAAGCCGAGCATTAGAATCCGAACTTTTCCGCGCAAATGAGACATGC
GCAAAATCCATGGCTTTCAAATCCACATACAACAACCTCCAAACATCCGGCCTCAATTTTGGTCCTTTGTTCCGA
AACCTCGGAGACGTTCGCGCAAGTGCCTGTGGACTTGGTAAGGTTGTTGGATCAGTTACAGTCCCGGACATTGCA
CAGTCTATGCCAAAGCAGTATCTACATTCTCATCTCATCCACCCTGCCACAATGGACAGCATGATCCACTTGATG
ATCGCGGCTGTTCTCGACTTTACCGGAAAGTCCACCCTGGATCAGATCAGATTGCCGACTTTCATACGCAATGTC
TGGGTATCAGCAGATTTGAATTCAGCCCCAGCCCACAAATTCACAGGACATGCAACCGTGTCTATGGTGGGATCT
GATAAATTTGAGGGCCAAATTCAAATGCTGGATGAGGAAACAAACACACTTCGCATCCGCATGGACGGTATTGAG
CTCACTCCACTGGAGTCTGGTCTTGCTGAAAGTAGTGAGCGAAAATTGTGCAGCGCAATTGAATTCAAGCCCGAC
CTCCATTTCATCGACTCAAAATCGGCCTGTGCACTAACTTCTCTCAATGCTACCGATGACACTGAGGCTTTGTAC
TGGGTAAAGCGTCTTCAGCTTGCAACGATGCTCTACGTCATGGATGCACTGGACGAGCTCAAGGATATTGATGCC
ATGAAACTCGATTTGCACATGCGAAGATTCTTTGACTGGATGGAGCATATGCAAGGATTGCTCGAGCGCAATGAA
ATAATACATCTGCCCTACAGTGAATTCCAATGCGCTTTTCAAGACGAGGCTCTCAAGGAAGCCATTGGCAAGGAA
ATCGAGGCCCACAGCGCCGAAGGCGCCATCACAGCCCGAATGGGCCGCAATATTGCTCAAGTCGTGCTCCAGGAG
ACTGATCCTCTGCATCTCATGTTTGGTCAAGACGCTGTGATGGAACAGGTGTACAAGGAAGGCCTTCACTTGTAT
AACCTGCCGCAGCATCTACAGAGCCACTTGTCTCTCCTCCGGCACCAGCATTCCGAGCTGAACATTCTCGAGATT
GGTGGTGGCACCGGCAGCTTCACTGCTGAAGTCTTGGCCGTCCTTTCTCCAGACCTTGCGAAGGACAAAGGAAGC
ATTGCCAGTTACACATTCACCGACATTTCATCCGGCTTCTTCGAGAAAGCAAAACAGCGTTTCCAAGCATGGTCC
GACATCATGAACTTCCAATCGCTCAATATCGAGCGAAGCCCTGTCGATCAGGGACTTCAGCTAGGGACATATGAC
TTAATATTCGCTGGCAATGTCATCCACGCTACTGCAAACTTGCAGAACGCATTGCAGAACCTGCGATCTCTATTG
AAGCCGGGTGGTCAGCTCATCATGCAGGAAGGGATCCGACAGGACTTCCTGTGGTACCCACTTGTTTTCGGTCAG
CTTCCAGGGTGGTGGCTAGGCGATGAGCCATGTCGCCAGTGGTGTCCCTACATCCCGGCTGAAGAATGGAATCCT
GTGCTGCTGAAAGCGGGATTCTCAGGAATTGATGTCGAGTATCCCAGTTCGAACGATCCAGATTTGACATGGCAG
AGTATTCTGGTTTCTTCTGCCATCGAAACACCCAAGGAGAAGTCATCTAATACTGCGGTTATCTTGACGTTCGGT
ACATTGAGATCCGAACAAGTCATTAAAGACCTCCAAGGTCTTCTGCCGGAATTGGGATACACGAATATCCTTGTT
AAGGAGCCTGCAGATGTGAAAAATTATATCCTGCCTGATGCACTTTTCGTGTCATTGATGGACTTGGAGTCTCCT
TACCTGTTCGATATGGACGAAGCGGAATACCACACACTCAAGAAGATGCTCAGCGAGTGCCAAAATCTACTGTGG
GTGACATGCAATCCTCTCATACAGCCACACGCAAGTATGAGCATTGGTCTTCTCCGAACAGTGCGCTGGGAGCGG
GATGCCGATGGCTCAAATATCGTCACCCTGACAGAGGCGGAGCCTGACATCACTTCGCCAAAGAGCCTTGCTACA
GCTATCGGCAAGATTGTCCAGCGGCAATTTGTGGACAACCCGGAGAATGATCGCCACGCCGAGTACATGTTGCAG
AATGATCTCATACACATTGGCCGTTTGAACGAGTGGGAGGCGGCAGATCAGTTTCTTGCTGCACAATCCTCTCAG
CAAGCTCCTCCTCAACTTCAACGCCTCGGTGATTATGATCATCCCATTGAGTTGCAGGAGACTGCTGTTAGCACC
AGCGAATACCACTGGGTCATAGATAAGGAACATGAGACACCGCAAAAAGACACCGAGGTCGAGATTGAGATTCGA
GCAATTGGTCTCTCTTCGAATGTTTATGCCGACCGCCTCGCGAATGAGGTTGCTGGTGTTGTGACCAAGGTTGGG
CCTGAAGTCGAAGGCCCGGCCCCGGGTGACAGAGTCATTTACATCTCAGGCGACAAAAAGGGTGGTTGTATCCGA
ACACATGGTCGAGCTGACCAAATGCAGCTCGTGAAGATCCCCGATGAGATTTCATTCGAAGTCGCGGCCGGTTTG
GCTTGGGCATACGCGACAGCAATCCAAGGACTCGGGGAGATAGCTCATCTGGCACCCGAGAACACTATCCTGATC
CATACCAGTGTAACGGATATCAGTCAAGCGGCCATTCAATATGCCCAGATGATCGGAGCTACAATCTACGCTACT
GTAGCAACCGTCGAGGAACGTGATTTGCTGGTCTCTAACTACGGTATATCCCAAGACCGTATCTTTTCCAGGAGG
GATCTGAGCTTCATCAAGGGTATTATGCGGTGCACAAACAATACTGGGGTTGACGTCGTCTTCAACGCACTGAGC
GGCGAGGCACTCCGGGGGTCAACGGCATGCCTCGCTCCATTTGGGGCATTTGTTCATGTGTCGAATCTAGATCTG
CGAGCTGATACTACAATTGAGCTAGCCTCTTTACCTCGCAATGTGAGCGTCTACACCGTCGACATTCCTTTACTG
GCTCAACATCGACCAAAATCGGTTCGTCTTCTGCTCATCGAGGCACTGAGACTGTACTCCGCAAAAAGGATCGGT
CAACTCCACACAACTGTCATGGACTTTACTCGGATCAAAGAGGGTATTCAAACTGCGCATAGCGGAGAAGCAGCA
AAAGTTGTGATTACACCTGATCCGTCCAACATGGTCCCTATGGTCCCACGACCTCTCCAGCCTTGTCACTTTGAT
CCACGCGCCTCGTACGTTCTTGCCGGTGGCTACGGCGGCTTAGGCCGAAGTTTAGCACGATGTATGGCATCTCGT
GGTGCAAAGAGCCTGATTATCCTATCTCGCTCATCAGCTTCAAGCTCAGAGAAAATGGAATTGATTGGCGATCTC
GATAGAATGGGATGCAAGGTCCATTCACTGATCTGCGATGTGGCCGACCTCTCTAACCTCCAACAATTGTCCAGA
GCAGCCTTTTCTAACTTACCGGCTATCAAAGGATGCATCCAAGCATCCATGGTCCTGCGGGATGGCGCCTTCGCC
GGACTCTCTTTCGATGACTGGAAAGCAGCCATTAGACCCAAAGTCCAAGGTTCCTGGAACCTGCACACAGTCCTA
CCGGACAGCATGGACTTCTTCATTATGCTCTCCTCAGTCGCAGGCATCTTCGGCAACCGCGGGCAGTCAAATTAC
GCCGCAGGCAATACCTTCCAAGACGCACTTGCCGCATACCGTGTTTCGAAAGGCATGCATGCAGCTAGCATCAAC
CTAGGCAGTGTATCGAACGTGGGCTGGGTAGCCGAGAACCGAAACTCGATGCGCACGCACACAGCCACGTTATTC
GAGCTTTTGCGCGAAGAAGAGGTCCACGCAACGGTTGACTTCCTTATCCGCGATCAGCAAGACGGCGGAAATGCA
TCACCGCGCTCACAGCTCATCCTCGGTCTGCCGACCGCGGAGATGTGTCGCCAGAACGGAGTGCCTTTACCTACG
TACCTGAATTACTCGATGTTCACGCACTTCCGTAACACGGCGACAGCGAAGAGCAGTGAGGTGTCTCTGCAGAAG
ACTGTCAGCACTGCTGCGCTTTTGTCGGCGGCTTCTGGCTTCGAGAGTGCTGTCGTTGTTGTGTCGGATGGGATT
GTTGAGAGACTTGCTTCGCTGCTTGCCATTCCTTGTTCCGAACTCGATGCACAGCGCTTTAGCTTTGGCGGCATT
GACTCCCTTGTTGCTATGGAGTTTCGCGCGTGGATCATCAAGGAGCTTAAGGCTGAGGTTTCTTTGCTTGATATT
ATGGGAGCGGAGAATATTAGGGCTTTGAGTGAAAAGATTGCCGGCAGGAGTCGTTTAATTGGAGGGTCTGGTGCT
TAA
Transcript >Pro_DTO377G3_2|g4183.t1
ATGCGTCCCCTCTCGCTGAAGACAGGCTCCAGTGGCGATGGAGCCATGCCTTCTGATGCTCTGGAACCCATCGCT
ATCATTGGCCTAGCCACCCACTTTCCAAAGCAAGCAACAACCACTGAGGGTCTGTGGGAGCTTCTCCTACAGGCC
CGCTCGACGTGGTCATCGATACCCAAAGAACGCTTCAACTCAGATGCCTTCTATCATCCAGATCCCGAGCATGGT
GGAACGTTTCATGTCCAAGGAGGTCACTACCTCTCAGAAGACCCCGCCTACTTCGATGGCTCCTTCTTCAATATT
ACCAAGAATGAGCTCCTGACATTGGATCCGCAGCAGCGGCTGGTACTCGAAAATGTCTACCATGCCTTGGAAAAT
GCTGGCATTCCATTGACCAGTGCTGTTGGCTCTAACACATCGGTTTTTGTTAGTGGATTCAACCATGACTACCTA
GGTATCCTCAATTCAGACCCAGAAACCACTTTGAAATACAAACCCACCGGTGTCACCAATGCCATTCTGTCTAAC
CGTGTCAGTTGGTTCTTTGACTTCAGAGGACCCAGCATGACCATTGATACGGCTTGTTCTAGTAGCTTGGTGGCA
CTGCACCTCGCTGTACAGAGCTTACGTGCCAATGAGACAATTATGGCTGTCGTCAGTGGTGTGAGCATTCTTGAA
AACCCCGCGGAAACCATCGGCATGAGTCACCATGGTTTGTTGGGACCTCAAGGGCGATCTTTCAGCTTCGACTCC
CGTGCCGAAGGCTATGCGCGAGGCGAAGGCGTGGGCACAGTTGTAGTGAAGCCTTTGAGTGTCGCTATCAGAGAT
GGAGATACCATCCGTGCGGTCATTCGAGAGACGGGAGTCAACCAGGATGGCCGCACGCCAGGGATTACAGTTCCT
AGCGCAGATGCCCAAGAAAGACTAATCCGTGAGGTCTACTGGAGAGCCGGCCTGGACCTCGAACACACAAGATTC
GTTGAAGCCCATGGCACTGGAACAAGCACCGGTGACCCTATCGAAGCGGGCGCTCTTGCAAGAGCATTCAAATGT
CGCCGAGAGACTCCGCTTTACGTCGGGGCGATCAAATCTTCCATTGGGCATCTGGAAGGTGGCTCAGGTGTGGCA
AGCCTCATCAAATCTATTCTAATACTTGAGTCTGGGATTATACCTGCAAACTTTGATATGAAGCAGACAAATTCC
TCTATTCCTGCAACTGAGTACGATATTGCATTCCCTACCGAGGCTCTTCCATGGCCATCTCCGGGCCTGCGAAGA
GTGTCAGTCAACTCATTTGGAATTGGTGGCACCAATGCTCACTGCATCCTTGATGACGCCTACCACTATCTGAAT
GACCACCGCCTTACAGGCGCCCACCGCACCACATCCACTGTTCCTACAACACAGAAAATCAACAGCCGGCTCTTG
GCCCTGTGTCGAACAGGAACGGAATCAAACCATTTCGTGACGGATTCATTCGATGACAGCGATCACTCTGGACAT
GGTAATACCTTTATGGACACACCCACAAGCGATGGCTTTTGTGAATCACCAACATTCGCATCATCCACATACACT
AGCTTGATCGAAAAACCAAAGCTGTTCTTACTCTCGGCTTTTGACGAAGATGGCGTCAAGCGGAACGCAGCTGAA
TTAGCCAAGTACTTGAACCGAAGAATGATGAAGTCAGTCCTCCATGACTATCTCCTTGATGACCTGTCCTTCACC
CTGTCGAAGAAACGATCCCATTTTCCCTGGAGGAGCTTCGTCATGGCATCCTCAGTCAAAGAACTCGCATGGAAC
CTGTCAGAAGCGAATTTTGCCAAGCCAATTAGAACTGCCAGAGTTCCGGAGGTTGAATTTGTTTTCACTGGCCAA
GGAGCTCAGTATCAGGCTATGGGCCGAGAGCTCATGGTCTATCCTGTATTTCAAGAGTCCGTGGAGGAAGCATCG
GACTATATCCGGCGGCTCGGTAGTCCGTGGTCGCTACTTGACGAACTCTTGACTGAAAGACAGTCACCCCGAGTC
AACTTGCCTGAGATAGCTCATCCGCTGTGCACAGTCTTGCAAATTGCGCTCGTGGATCTTCTGACCAGTTGGGGA
ATCTTCCCAAAACGTGTAACGGGTCACTCATCCGGCGAGATAGCCGCCGCTTACTGCTCTGGCAAGCTATCCCGC
GAAGGTTCTTGGAAGGTTGCATACTATCGTGGATACGTATCATCCAAACAGCTTTCCGCAAATGGAGCTATGATG
GCCGTGGGCCTGGATGCATCGCAACTGCAACCTTATCTGGACTCTGTGAGGAAGGACAACGCCGGGGAGCTCATC
ATCGCCTGCCGCAACAGTCCCAAAAACAACACCGTTTCTGGAGACGAAGCTATGATCGACTGCCTCAAGAGTCTT
CTCGATGCTGATGCCATCTTTGCTCGAAAGTTGAACGTCAAGAATGCTTATCACTCGGCCCACATGCATGCGATC
GCTCAGGATTACCTTAGTCTAATGGGAATGCTTTCTTTTGGAAGGCGGCTGGCAGCTCCACATCAAGTGCATATG
TTTTCCACCGTCACAGGACAACAAGTCCAAGAGGAACACCTGCCTGCACAATACTGGGTGGACAATATGGTTTCT
CCTGTTCTTTTCACAAGCGGGTTGGTTGCAATGACCTCAAACCAAATTTCCAGTCATGACTCGATTGATTCCACG
GATTCTCTGCGCCTTATCGTGGAAATAGGGCCTCACACAACCCTTCAGAGTGCCATCAAAGAGACATTGGCCTCG
AAGAGCCCCAAGTTGGAATTTAAGTACCTAGCCGTTCTCAAACGGACAGATCACAGCCTCAACACTCTACTAACT
ACAGTCGGCTTCCTAGGTTCAAGTGGATGTGAACTAGATCTTCATGCTGTGAACCAAGGTTCTTGCTTCAAGGCA
AGAAGACGGCCCAGACTGTTGGTGGACCTGCCGCCATACAGCTTCAAACATACCGAGAAGATTTTATTTGAGTCT
CGACTGAGCAAGAATCTGCGAACTCGAAAGTTCCCTCGTCATGACCTCTTCGGTGCACCTATCACGGATTGGAAT
CCTACAGCCCCAAGATGGAGACATTTTGTCCGATTGAACGAAAACCCTTGGTTAAGGGATCATGTGGTCACTGGA
AACTATGTCTATCCTGGTGTGGGTTATTTGATCATGGCAATTGAAGCATCGAGGCAGTTGGTCGGCGAGGCAAAG
ATCATTGGTTTCCAACTACGAAAAGTCAACATCCGAAGAGCCTTGATTGTACCCGATACCAAAGAAGGAATTGAG
GTTTCCTTGGCAATGGCAACTGTCGAAGACTCGTCATCGTCGCGAACGTGGAGGCGATTCCAGATAACTTCCTAC
AATGCATCGAGCGACCAGTGGACAGAACATTGCACTGGTTACATCACCGTCGACCACGAAACAGCTTTCGATCCA
ATTGACAATGGCCGCGAAGCAGAAGAAGAAAGCCGAGCATTAGAATCCGAACTTTTCCGCGCAAATGAGACATGC
GCAAAATCCATGGCTTTCAAATCCACATACAACAACCTCCAAACATCCGGCCTCAATTTTGGTCCTTTGTTCCGA
AACCTCGGAGACGTTCGCGCAAGTGCCTGTGGACTTGGTAAGGTTGTTGGATCAGTTACAGTCCCGGACATTGCA
CAGTCTATGCCAAAGCAGTATCTACATTCTCATCTCATCCACCCTGCCACAATGGACAGCATGATCCACTTGATG
ATCGCGGCTGTTCTCGACTTTACCGGAAAGTCCACCCTGGATCAGATCAGATTGCCGACTTTCATACGCAATGTC
TGGGTATCAGCAGATTTGAATTCAGCCCCAGCCCACAAATTCACAGGACATGCAACCGTGTCTATGGTGGGATCT
GATAAATTTGAGGGCCAAATTCAAATGCTGGATGAGGAAACAAACACACTTCGCATCCGCATGGACGGTATTGAG
CTCACTCCACTGGAGTCTGGTCTTGCTGAAAGTAGTGAGCGAAAATTGTGCAGCGCAATTGAATTCAAGCCCGAC
CTCCATTTCATCGACTCAAAATCGGCCTGTGCACTAACTTCTCTCAATGCTACCGATGACACTGAGGCTTTGTAC
TGGGTAAAGCGTCTTCAGCTTGCAACGATGCTCTACGTCATGGATGCACTGGACGAGCTCAAGGATATTGATGCC
ATGAAACTCGATTTGCACATGCGAAGATTCTTTGACTGGATGGAGCATATGCAAGGATTGCTCGAGCGCAATGAA
ATAATACATCTGCCCTACAGTGAATTCCAATGCGCTTTTCAAGACGAGGCTCTCAAGGAAGCCATTGGCAAGGAA
ATCGAGGCCCACAGCGCCGAAGGCGCCATCACAGCCCGAATGGGCCGCAATATTGCTCAAGTCGTGCTCCAGGAG
ACTGATCCTCTGCATCTCATGTTTGGTCAAGACGCTGTGATGGAACAGGTGTACAAGGAAGGCCTTCACTTGTAT
AACCTGCCGCAGCATCTACAGAGCCACTTGTCTCTCCTCCGGCACCAGCATTCCGAGCTGAACATTCTCGAGATT
GGTGGTGGCACCGGCAGCTTCACTGCTGAAGTCTTGGCCGTCCTTTCTCCAGACCTTGCGAAGGACAAAGGAAGC
ATTGCCAGTTACACATTCACCGACATTTCATCCGGCTTCTTCGAGAAAGCAAAACAGCGTTTCCAAGCATGGTCC
GACATCATGAACTTCCAATCGCTCAATATCGAGCGAAGCCCTGTCGATCAGGGACTTCAGCTAGGGACATATGAC
TTAATATTCGCTGGCAATGTCATCCACGCTACTGCAAACTTGCAGAACGCATTGCAGAACCTGCGATCTCTATTG
AAGCCGGGTGGTCAGCTCATCATGCAGGAAGGGATCCGACAGGACTTCCTGTGGTACCCACTTGTTTTCGGTCAG
CTTCCAGGGTGGTGGCTAGGCGATGAGCCATGTCGCCAGTGGTGTCCCTACATCCCGGCTGAAGAATGGAATCCT
GTGCTGCTGAAAGCGGGATTCTCAGGAATTGATGTCGAGTATCCCAGTTCGAACGATCCAGATTTGACATGGCAG
AGTATTCTGGTTTCTTCTGCCATCGAAACACCCAAGGAGAAGTCATCTAATACTGCGGTTATCTTGACGTTCGGT
ACATTGAGATCCGAACAAGTCATTAAAGACCTCCAAGGTCTTCTGCCGGAATTGGGATACACGAATATCCTTGTT
AAGGAGCCTGCAGATGTGAAAAATTATATCCTGCCTGATGCACTTTTCGTGTCATTGATGGACTTGGAGTCTCCT
TACCTGTTCGATATGGACGAAGCGGAATACCACACACTCAAGAAGATGCTCAGCGAGTGCCAAAATCTACTGTGG
GTGACATGCAATCCTCTCATACAGCCACACGCAAGTATGAGCATTGGTCTTCTCCGAACAGTGCGCTGGGAGCGG
GATGCCGATGGCTCAAATATCGTCACCCTGACAGAGGCGGAGCCTGACATCACTTCGCCAAAGAGCCTTGCTACA
GCTATCGGCAAGATTGTCCAGCGGCAATTTGTGGACAACCCGGAGAATGATCGCCACGCCGAGTACATGTTGCAG
AATGATCTCATACACATTGGCCGTTTGAACGAGTGGGAGGCGGCAGATCAGTTTCTTGCTGCACAATCCTCTCAG
CAAGCTCCTCCTCAACTTCAACGCCTCGGTGATTATGATCATCCCATTGAGTTGCAGGAGACTGCTGTTAGCACC
AGCGAATACCACTGGGTCATAGATAAGGAACATGAGACACCGCAAAAAGACACCGAGGTCGAGATTGAGATTCGA
GCAATTGGTCTCTCTTCGAATGTTTATGCCGACCGCCTCGCGAATGAGGTTGCTGGTGTTGTGACCAAGGTTGGG
CCTGAAGTCGAAGGCCCGGCCCCGGGTGACAGAGTCATTTACATCTCAGGCGACAAAAAGGGTGGTTGTATCCGA
ACACATGGTCGAGCTGACCAAATGCAGCTCGTGAAGATCCCCGATGAGATTTCATTCGAAGTCGCGGCCGGTTTG
GCTTGGGCATACGCGACAGCAATCCAAGGACTCGGGGAGATAGCTCATCTGGCACCCGAGAACACTATCCTGATC
CATACCAGTGTAACGGATATCAGTCAAGCGGCCATTCAATATGCCCAGATGATCGGAGCTACAATCTACGCTACT
GTAGCAACCGTCGAGGAACGTGATTTGCTGGTCTCTAACTACGGTATATCCCAAGACCGTATCTTTTCCAGGAGG
GATCTGAGCTTCATCAAGGGTATTATGCGGTGCACAAACAATACTGGGGTTGACGTCGTCTTCAACGCACTGAGC
GGCGAGGCACTCCGGGGGTCAACGGCATGCCTCGCTCCATTTGGGGCATTTGTTCATGTGTCGAATCTAGATCTG
CGAGCTGATACTACAATTGAGCTAGCCTCTTTACCTCGCAATGTGAGCGTCTACACCGTCGACATTCCTTTACTG
GCTCAACATCGACCAAAATCGGTTCGTCTTCTGCTCATCGAGGCACTGAGACTGTACTCCGCAAAAAGGATCGGT
CAACTCCACACAACTGTCATGGACTTTACTCGGATCAAAGAGGGTATTCAAACTGCGCATAGCGGAGAAGCAGCA
AAAGTTGTGATTACACCTGATCCGTCCAACATGGTCCCTATGGTCCCACGACCTCTCCAGCCTTGTCACTTTGAT
CCACGCGCCTCGTACGTTCTTGCCGGTGGCTACGGCGGCTTAGGCCGAAGTTTAGCACGATGTATGGCATCTCGT
GGTGCAAAGAGCCTGATTATCCTATCTCGCTCATCAGCTTCAAGCTCAGAGAAAATGGAATTGATTGGCGATCTC
GATAGAATGGGATGCAAGGTCCATTCACTGATCTGCGATGTGGCCGACCTCTCTAACCTCCAACAATTGTCCAGA
GCAGCCTTTTCTAACTTACCGGCTATCAAAGGATGCATCCAAGCATCCATGGTCCTGCGGGATGGCGCCTTCGCC
GGACTCTCTTTCGATGACTGGAAAGCAGCCATTAGACCCAAAGTCCAAGGTTCCTGGAACCTGCACACAGTCCTA
CCGGACAGCATGGACTTCTTCATTATGCTCTCCTCAGTCGCAGGCATCTTCGGCAACCGCGGGCAGTCAAATTAC
GCCGCAGGCAATACCTTCCAAGACGCACTTGCCGCATACCGTGTTTCGAAAGGCATGCATGCAGCTAGCATCAAC
CTAGGCAGTGTATCGAACGTGGGCTGGGTAGCCGAGAACCGAAACTCGATGCGCACGCACACAGCCACGTTATTC
GAGCTTTTGCGCGAAGAAGAGGTCCACGCAACGGTTGACTTCCTTATCCGCGATCAGCAAGACGGCGGAAATGCA
TCACCGCGCTCACAGCTCATCCTCGGTCTGCCGACCGCGGAGATGTGTCGCCAGAACGGAGTGCCTTTACCTACG
TACCTGAATTACTCGATGTTCACGCACTTCCGTAACACGGCGACAGCGAAGAGCAGTGAGGTGTCTCTGCAGAAG
ACTGTCAGCACTGCTGCGCTTTTGTCGGCGGCTTCTGGCTTCGAGAGTGCTGTCGTTGTTGTGTCGGATGGGATT
GTTGAGAGACTTGCTTCGCTGCTTGCCATTCCTTGTTCCGAACTCGATGCACAGCGCTTTAGCTTTGGCGGCATT
GACTCCCTTGTTGCTATGGAGTTTCGCGCGTGGATCATCAAGGAGCTTAAGGCTGAGGTTTCTTTGCTTGATATT
ATGGGAGCGGAGAATATTAGGGCTTTGAGTGAAAAGATTGCCGGCAGGAGTCGTTTAATTGGAGGGTCTGGTGCT
TAA
Gene >Pro_DTO377G3_2|g4183.t1
ATGCGTCCCCTCTCGCTGAAGACAGGCTCCAGTGGCGATGGAGCCATGCCTTCTGATGCTCTGGAACCCATCGCT
ATCATTGGCCTAGCCACCCACTTTCCAAAGCAAGCAACAACCACTGAGGGTCTGTGGGAGCTTCTCCTACAGGCC
CGCTCGACGTGGTCATCGATACCCAAAGAACGCTTCAACTCAGATGCCTTCTATCATCCAGATCCCGAGCATGGT
GGAACGGTAAGTCATACCCGAGCTATGACAGACCAACATCAACATGAATAATCGGTTAACAGATATCTGTCTAGT
TTCATGTCCAAGGAGGTCACTACCTCTCAGAAGACCCCGCCTACTTCGATGGCTCCTTCTTCAATATTACCAAGA
ATGAGCTCCTGACATTGGATCCGCAGCAGCGGCTGGTACTCGAAAATGTCTACCATGCCTTGGAAAATGCTGGCA
TTCCATTGACCAGTGCTGTTGGCTCTAACACATCGGTTTTTGTTAGTGGATTCAACCATGACTACCTAGGTATCC
TCAATTCAGACCCAGAAACCACTTTGAAATACAAACCCACCGGTGTCACCAATGCCATTCTGTCTAACCGTGTCA
GTTGGTTCTTTGACTTCAGAGGACCCAGCATGACCATTGATACGGCTTGTTCTAGTAGCTTGGTGGCACTGCACC
TCGCTGTACAGAGCTTACGTGCCAATGAGACAATTATGGTATGTTACCATATACCTTGTGTTGATATTGATACTA
TGCTGATAATATGCTGATAACGTTTAAGGCTGTCGTCAGTGGTGTGAGCATTCTTGAAAACCCCGCGGAAACCAT
CGGCATGAGTCACCATGGTTTGTTGGGACCTCAAGGGCGATCTTTCAGCTTCGACTCCCGTGCCGAAGGCTATGC
GCGAGGCGAAGGCGTGGGCACAGTTGTAGTGAAGCCTTTGAGTGTCGCTATCAGAGATGGAGATACCATCCGTGC
GGTCATTCGAGAGACGGGAGTCAACCAGGATGGCCGCACGCCAGGGATTACAGTTCCTAGCGCAGATGCCCAAGA
AAGACTAATCCGTGAGGTCTACTGGAGAGCCGGCCTGGACCTCGAACACACAAGATTCGTTGAAGCCCATGGCAC
TGGAACAAGCACCGGTGACCCTATCGAAGCGGGCGCTCTTGCAAGAGCATTCAAATGTCGCCGAGAGACTCCGCT
TTACGTCGGGGCGATCAAATCTTCCATTGGGCATCTGGAAGGTGGCTCAGGTGTGGCAAGCCTCATCAAATCTAT
TCTAATACTTGAGTCTGGGATTATACCTGCAAACTTTGATATGAAGCAGACAAATTCCTCTATTCCTGCAACTGA
GTACGATATTGCATTCCCTACCGAGGCTCTTCCATGGCCATCTCCGGGCCTGCGAAGAGTGTCAGTCAACTCATT
TGGAATTGGTGGCACCAATGCTCACTGCATCCTTGATGACGCCTACCACTATCTGAATGACCACCGCCTTACAGG
CGCCCACCGCACCACATCCACTGTTCCTACAACACAGAAAATCAACAGCCGGCTCTTGGCCCTGTGTCGAACAGG
AACGGAATCAAACCATTTCGTGACGGATTCATTCGATGACAGCGATCACTCTGGACATGGTAATACCTTTATGGA
CACACCCACAAGCGATGGCTTTTGTGAATCACCAACATTCGCATCATCCACATACACTAGCTTGATCGAAAAACC
AAAGCTGTTCTTACTCTCGGCTTTTGACGAAGATGGCGTCAAGCGGAACGCAGCTGAATTAGCCAAGTACTTGAA
CCGAAGAATGATGAAGTCAGTCCTCCATGACTATCTCCTTGATGACCTGTCCTTCACCCTGTCGAAGAAACGATC
CCATTTTCCCTGGAGGAGCTTCGTCATGGCATCCTCAGTCAAAGAACTCGCATGGAACCTGTCAGAAGCGAATTT
TGCCAAGCCAATTAGAACTGCCAGAGTTCCGGAGGTTGAATTTGTTTTCACTGGCCAAGGAGCTCAGTATCAGGC
TATGGGCCGAGAGCTCATGGTCTATCCTGTATTTCAAGAGTCCGTGGAGGAAGCATCGGACTATATCCGGCGGCT
CGGTAGTCCGTGGTCGCTACTTGGTAATCATTTTCTTGCCTCTTTTGTCTAATGTGCTTGACTAACGTATCACAG
ACGAACTCTTGACTGAAAGACAGTCACCCCGAGTCAACTTGCCTGAGATAGCTCATCCGCTGTGCACAGTCTTGC
AAATTGCGCTCGTGGATCTTCTGACCAGTTGGGGAATCTTCCCAAAACGTGTAACGGGTCACTCATCCGGCGAGA
TAGCCGCCGCTTACTGCTCTGGCAAGCTATCCCGCGAAGGTTCTTGGAAGGTTGCATACTATCGTGGATACGTAT
CATCCAAACAGCTTTCCGCAAATGGAGCTATGATGGCCGTGGGCCTGGATGCATCGCAACTGCAACCTTATCTGG
ACTCTGTGAGGAAGGACAACGCCGGGGAGCTCATCATCGCCTGCCGCAACAGTCCCAAAAACAACACCGTTTCTG
GAGACGAAGCTATGATCGACTGCCTCAAGAGTCTTCTCGATGCTGATGCCATCTTTGCTCGAAAGTTGAACGTCA
AGAATGCTTATCACTCGGCCCACATGCATGCGATCGCTCAGGATTACCTTAGTCTAATGGGAATGCTTTCTTTTG
GAAGGCGGCTGGCAGCTCCACATCAAGTGCATATGTTTTCCACCGTCACAGGACAACAAGTCCAAGAGGAACACC
TGCCTGCACAATACTGGGTGGACAATATGGTTTCTCCTGTTCTTTTCACAAGCGGGTTGGTTGCAATGACCTCAA
ACCAAATTTCCAGTCATGACTCGATTGATTCCACGGATTCTCTGCGCCTTATCGTGGAAATAGGGCCTCACACAA
CCCTTCAGAGTGCCATCAAAGAGACATTGGCCTCGAAGAGCCCCAAGTTGGAATTTAAGTACCTAGCCGTTCTCA
AACGGACAGATCACAGCCTCAACACTCTACTAACTACAGTCGGCTTCCTAGGTTCAAGTGGATGTGAACTAGATC
TTCATGCTGTGAACCAAGGTTCTTGCTTCAAGGCAAGAAGACGGCCCAGACTGTTGGTGGACCTGCCGCCATACA
GCTTCAAACATACCGAGAAGATTTTATTTGAGTCTCGACTGAGCAAGAATCTGCGAACTCGAAAGTTCCCTCGTC
ATGACCTCTTCGGTGCACCTATCACGGATTGGAATCCTACAGCCCCAAGATGGAGACATTTTGTCCGATTGAACG
AAAACCCTTGGTTAAGGGATCATGTGGTAAGTTCGAAGTTGTCTCCAAAATAGCCTCACTCATTGACACAGCCTA
GGTCACTGGAAACTATGTCTATCCTGGTGTGGGTTATTTGATCATGGCAATTGAAGCATCGAGGCAGTTGGTCGG
CGAGGCAAAGATCATTGGTTTCCAACTACGAAAAGTCAACATCCGAAGAGCCTTGATTGTACCCGATACCAAAGA
AGGAATTGAGGTTTCCTTGGCAATGGCAACTGTCGAAGACTCGTCATCGTCGCGAACGTGGAGGCGATTCCAGAT
AACTTCCTACAATGCATCGAGCGACCAGTGGACAGAACATTGCACTGGTTACATCACCGTCGACCACGAAACAGC
TTTCGATCCAATTGACAATGGCCGCGAAGCAGAAGAAGAAAGCCGAGCATTAGAATCCGAACTTTTCCGCGCAAA
TGAGACATGCGCAAAATCCATGGCTTTCAAATCCACATACAACAACCTCCAAACATCCGGCCTCAATTTTGGTCC
TTTGTTCCGAAACCTCGGAGACGTTCGCGCAAGTGCCTGTGGACTTGGTAAGGTTGTTGGATCAGTTACAGTCCC
GGACATTGCACAGTCTATGCCAAAGCAGTATCTACATTCTCATCTCATCCACCCTGCCACAATGGACAGCATGAT
CCACTTGATGATCGCGGCTGTTCTCGACTTTACCGGAAAGTCCACCCTGGATCAGATCAGATTGCCGACTTTCAT
ACGCAATGTCTGGGTATCAGCAGATTTGAATTCAGCCCCAGCCCACAAATTCACAGGACATGCAACCGTGTCTAT
GGTGGGATCTGATAAATTTGAGGGCCAAATTCAAATGCTGGATGAGGAAACAAACACACTTCGCATCCGCATGGA
CGGTATTGAGCTCACTCCACTGGAGTCTGGTCTTGCTGAAAGTAGTGAGCGAAAATTGTGCAGCGCAATTGAATT
CAAGCCCGACCTCCATTTCATCGACTCAAAATCGGCCTGTGCACTAACTTCTCTCAATGCTACCGATGACACTGA
GGCTTTGTACTGGGTAAAGCGTCTTCAGCTTGCAACGATGCTCTACGTCATGGATGCACTGGACGAGCTCAAGGA
TATTGATGCCATGAAACTCGATTTGCACATGCGAAGATTCTTTGACTGGATGGAGCATATGCAAGGATTGCTCGA
GCGCAATGAAATAATACATCTGCCCTACAGTGAATTCCAATGCGCTTTTCAAGACGAGGCTCTCAAGGAAGCCAT
TGGCAAGGAAATCGAGGCCCACAGCGCCGAAGGCGCCATCACAGCCCGAATGGGCCGCAATATTGCTCAAGTCGT
GCTCCAGGAGACTGATCCTCTGCATCTCATGTTTGGTCAAGACGCTGTGATGGAACAGGTGTACAAGGAAGGCCT
TCACTTGTATAACCTGCCGCAGCATCTACAGAGCCACTTGTCTCTCCTCCGGCACCAGCATTCCGAGCTGAACAT
TCTCGAGATTGGTGGTGGCACCGGCAGCTTCACTGCTGAAGTCTTGGCCGTCCTTTCTCCAGACCTTGCGAAGGA
CAAAGGAAGCATTGCCAGTTACACATTCACCGACATTTCATCCGGCTTCTTCGAGAAAGCAAAACAGCGTTTCCA
AGCATGGTCCGACATCATGAACTTCCAATCGCTCAATATCGAGCGAAGCCCTGTCGATCAGGGACTTCAGCTAGG
GACATATGACTTAATATTCGCTGGCAATGTCATCCACGCTACTGCAAACTTGCAGAACGCATTGCAGAACCTGCG
ATCTCTATTGAAGCCGGGTGGTCAGCTCATCATGCAGGAAGGGATCCGACAGGACTTCCTGTGGTACCCACTTGT
TTTCGGTCAGCTTCCAGGGTGGTGGCTAGGCGATGAGCCATGTCGCCAGTGGTGTCCCTACATCCCGGCTGAAGA
ATGGAATCCTGTGCTGCTGAAAGCGGGATTCTCAGGAATTGATGTCGAGTATCCCAGTTCGAACGATCCAGATTT
GACATGGCAGAGTATTCTGGTTTCTTCTGCCATCGAAACACCCAAGGAGAAGTCATCTAATACTGCGGTTATCTT
GACGTTCGGTACATTGAGATCCGAACAAGTCATTAAAGACCTCCAAGGTCTTCTGCCGGAATTGGGATACACGAA
TATCCTTGTTAAGGAGCCTGCAGATGTGAAAAATTATATCCTGCCTGATGCACTTTTCGTGTCATTGATGGACTT
GGAGTCTCCTTACCTGTTCGATATGGACGAAGCGGAATACCACACACTCAAGAAGATGCTCAGCGAGTGCCAAAA
TCTACTGTGGGTGACATGCAATCCTCTCATACAGCCACACGCAAGTATGAGCATTGGTCTTCTCCGAACAGTGCG
CTGGGAGCGGGATGCCGATGGCTCAAATATCGTCACCCTGACAGAGGCGGAGCCTGACATCACTTCGCCAAAGAG
CCTTGCTACAGCTATCGGCAAGATTGTCCAGCGGCAATTTGTGGACAACCCGGAGAATGATCGCCACGCCGAGTA
CATGTTGCAGAATGATCTCATACACATTGGCCGTTTGAACGAGTGGGAGGCGGCAGATCAGTTTCTTGCTGCACA
ATCCTCTCAGCAAGCTCCTCCTCAACTTCAACGCCTCGGTGATTATGATCATCCCATTGAGTTGCAGGAGACTGC
TGTTAGCACCAGCGAATACCACTGGGTCATAGATAAGGAACATGAGACACCGCAAAAAGACACCGAGGTCGAGAT
TGAGATTCGAGCAATTGGTCTCTCTTCGAATGTTTATGCCGACCGCCTCGCGAATGAGGTTGCTGGTGTTGTGAC
CAAGGTTGGGCCTGAAGTCGAAGGCCCGGCCCCGGGTGACAGAGTCATTTACATCTCAGGCGACAAAAAGGGTGG
TTGTATCCGAACACATGGTCGAGCTGACCAAATGCAGCTCGTGAAGATCCCCGATGAGATTTCATTCGAAGTCGC
GGCCGGTTTGGCTTGGGCATACGCGACAGCAATCCAAGGACTCGGGGAGATAGCTCATCTGGCACCCGAGAACAC
TATCCTGATCCATACCAGTGTAACGGATATCAGTCAAGCGGCCATTCAATATGCCCAGATGATCGGAGCTACAAT
CTACGCTACTGTAGCAACCGTCGAGGAACGTGATTTGCTGGTCTCTAACTACGGTATATCCCAAGACCGTATCTT
TTCCAGGAGGGATCTGAGCTTCATCAAGGGTATTATGCGGTGCACAAACAATACTGGGGTTGACGTCGTCTTCAA
CGCACTGAGCGGCGAGGCACTCCGGGGGTCAACGGCATGCCTCGCTCCATTTGGGGCATTTGTTCATGTGTCGAA
TCTAGATCTGCGAGCTGATACTACAATTGAGCTAGCCTCTTTACCTCGCAATGTGAGCGTCTACACCGTCGACAT
TCCTTTACTGGCTCAACATCGACCAAAATCGGTTCGTCTTCTGCTCATCGAGGCACTGAGACTGTACTCCGCAAA
AAGGATCGGTCAACTCCACACAACTGTCATGGACTTTACTCGGATCAAAGAGGGTATTCAAACTGCGCATAGCGG
AGAAGCAGCAAAAGTTGTGATTACACCTGATCCGTCCAACATGGTCCCTATGGTCCCACGACCTCTCCAGCCTTG
TCACTTTGATCCACGCGCCTCGTACGTTCTTGCCGGTGGCTACGGCGGCTTAGGCCGAAGTTTAGCACGATGTAT
GGCATCTCGTGGTGCAAAGAGCCTGATTATCCTATCTCGCTCATCAGCTTCAAGCTCAGAGAAAATGGAATTGAT
TGGCGATCTCGATAGAATGGGATGCAAGGTCCATTCACTGATCTGCGATGTGGCCGACCTCTCTAACCTCCAACA
ATTGTCCAGAGCAGCCTTTTCTAACTTACCGGCTATCAAAGGATGCATCCAAGCATCCATGGTCCTGCGGGTAAG
TCCCCGGTCCTCACTCCTCGGTACTAAATATACACAAACTAACATATTCGTAGGATGGCGCCTTCGCCGGACTCT
CTTTCGATGACTGGAAAGCAGCCATTAGACCCAAAGTCCAAGGTTCCTGGAACCTGCACACAGTCCTACCGGACA
GCATGGACTTCTTCATTATGCTCTCCTCAGTCGCAGGCATCTTCGGCAACCGCGGGCAGTCAAATTACGCCGCAG
GCAATACCTTCCAAGACGCACTTGCCGCATACCGTGTTTCGAAAGGCATGCATGCAGCTAGCATCAACCTAGGCA
GTGTATCGAACGTGGGCTGGGTAGCCGAGAACCGAAACTCGATGCGCACGCACACAGCCACGTTATTCGAGCTTT
TGCGCGAAGAAGAGGTCCACGCAACGGTTGACTTCCTTATCCGCGATCAGCAAGACGGCGGAAATGCATCACCGC
GCTCACAGCTCATCCTCGGTCTGCCGACCGCGGAGATGTGTCGCCAGAACGGAGTGCCTTTACCTACGTACCTGA
ATTACTCGATGTTCACGCACTTCCGTAACACGGCGACAGCGAAGAGCAGTGAGGTGTCTCTGCAGAAGACTGTCA
GCACTGCTGCGCTTTTGTCGGCGGCTTCTGGCTTCGAGAGTGCTGTCGTTGTTGTGTCGGATGGGATTGTTGAGA
GACTTGCTTCGCTGCTTGCCATTCCTTGTTCCGAACTCGATGCACAGCGCTTTAGCTTTGGCGGCATTGACTCCC
TTGTTGCTATGGAGTTTCGCGCGTGGATCATCAAGGAGCTTAAGGCTGAGGTTTCTTTGCTTGATATTATGGGAG
CGGAGAATATTAGGGCTTTGAGTGAAAAGATTGCCGGCAGGAGTCGTTTAATTGGAGGGTCTGGTGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail