Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4182.t1
Gene name
Locationscaffold_08:276140..277512
Strand+
Gene length (bp)1372
Transcript length (bp)1269
Coding sequence length (bp)1269
Protein length (aa) 423

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 2.3E-24 24 86
PF01556 DnaJ_C DnaJ C terminal domain 1.1E-23 135 377
PF00684 DnaJ_CXXCXGXG DnaJ central domain 6.3E-15 162 225

GO

GO Term Description Terminal node
GO:0051082 unfolded protein binding Yes
GO:0031072 heat shock protein binding Yes
GO:0005515 protein binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 3 22 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4182.t1
MQLLRLLVTLAVVLFSVVVIAAEDYYKVLGLAKSASERDIKRAYRTLSKKYHPDKNPGDDTAREKFVEIADAYDV
LSTTTLRKVYDQYGHEGVEQHRKGGAAGGGGHDPFDLFSRFFGGGGHSGHAPGHRRGPDMEVRAALPLRDFYNGR
EINFLVEKQQICDSCEGTGSKDRQVVTCDRCAGRGIVIQKHMLAPGMFQQVQMQCDKCHGQGKKIKNPCPVCEGN
RVVRNQVETSATIEPGMGKGTRLVFENEADESPDWIAGDLIVVLDEKEPELGESEEERTDGTFFRRKGKDLFWKE
SLSLREAWMGDWSRNLTHLDGHIVRLGRGRGEVVQPLAVETIAGEGMPHYSEGHLHDHHEENDEAGNLFIEYTVV
LPDQMESGMEKDFHALWEKWRKKIGVDLAEDSGRPVVPPPAEDKDEL*
Coding >Pro_DTO377G3_2|g4182.t1
ATGCAATTATTACGACTCCTGGTCACACTAGCTGTAGTGCTATTCTCAGTTGTTGTAATCGCTGCTGAGGATTAC
TACAAGGTGCTTGGTCTCGCGAAGTCCGCGTCGGAGAGGGACATCAAGCGCGCATACAGAACACTAAGCAAGAAA
TACCACCCTGACAAGAATCCCGGCGATGACACAGCGCGCGAAAAATTTGTCGAAATAGCAGACGCCTACGATGTG
CTTTCGACCACCACGCTGCGCAAAGTGTACGACCAATATGGCCACGAAGGGGTGGAGCAGCACCGCAAGGGCGGA
GCGGCCGGCGGCGGCGGCCACGATCCATTCGATCTGTTTTCGCGATTCTTCGGCGGGGGTGGACACTCCGGTCAC
GCGCCTGGACACCGCCGCGGACCGGACATGGAAGTGCGAGCGGCGCTACCGCTGCGGGATTTCTACAATGGGCGC
GAGATCAACTTCCTCGTGGAGAAGCAGCAGATTTGCGATTCGTGTGAGGGAACGGGATCCAAGGATCGACAGGTT
GTGACTTGTGATCGGTGCGCAGGGCGTGGTATCGTTATTCAGAAACATATGCTTGCGCCGGGGATGTTCCAGCAA
GTGCAGATGCAGTGTGACAAGTGTCATGGGCAGGGAAAGAAGATTAAGAATCCTTGTCCTGTTTGTGAGGGGAAT
CGGGTCGTTAGGAATCAGGTTGAGACTAGTGCTACTATTGAGCCGGGGATGGGGAAGGGGACTAGGCTTGTTTTT
GAGAATGAAGCTGATGAGAGTCCGGACTGGATTGCTGGGGATTTGATTGTTGTTTTGGATGAGAAAGAGCCCGAG
CTTGGAGAGTCGGAGGAGGAGAGGACAGATGGGACGTTTTTCCGGCGGAAGGGGAAGGATCTGTTCTGGAAGGAG
AGTCTTTCGCTGCGCGAGGCGTGGATGGGTGACTGGAGTCGCAATCTTACGCATCTTGATGGGCACATTGTTCGT
CTTGGACGTGGTCGTGGTGAGGTCGTGCAGCCATTGGCTGTCGAGACTATTGCCGGGGAGGGCATGCCGCATTAC
TCCGAGGGTCATTTACATGATCACCATGAAGAGAATGATGAAGCGGGCAATCTGTTTATTGAGTATACTGTTGTC
CTGCCAGATCAGATGGAGAGTGGGATGGAGAAGGACTTCCATGCTCTTTGGGAGAAGTGGCGCAAGAAGATTGGA
GTTGATTTGGCGGAGGACTCTGGGCGACCGGTTGTGCCTCCGCCGGCGGAGGATAAGGATGAGCTGTGA
Transcript >Pro_DTO377G3_2|g4182.t1
ATGCAATTATTACGACTCCTGGTCACACTAGCTGTAGTGCTATTCTCAGTTGTTGTAATCGCTGCTGAGGATTAC
TACAAGGTGCTTGGTCTCGCGAAGTCCGCGTCGGAGAGGGACATCAAGCGCGCATACAGAACACTAAGCAAGAAA
TACCACCCTGACAAGAATCCCGGCGATGACACAGCGCGCGAAAAATTTGTCGAAATAGCAGACGCCTACGATGTG
CTTTCGACCACCACGCTGCGCAAAGTGTACGACCAATATGGCCACGAAGGGGTGGAGCAGCACCGCAAGGGCGGA
GCGGCCGGCGGCGGCGGCCACGATCCATTCGATCTGTTTTCGCGATTCTTCGGCGGGGGTGGACACTCCGGTCAC
GCGCCTGGACACCGCCGCGGACCGGACATGGAAGTGCGAGCGGCGCTACCGCTGCGGGATTTCTACAATGGGCGC
GAGATCAACTTCCTCGTGGAGAAGCAGCAGATTTGCGATTCGTGTGAGGGAACGGGATCCAAGGATCGACAGGTT
GTGACTTGTGATCGGTGCGCAGGGCGTGGTATCGTTATTCAGAAACATATGCTTGCGCCGGGGATGTTCCAGCAA
GTGCAGATGCAGTGTGACAAGTGTCATGGGCAGGGAAAGAAGATTAAGAATCCTTGTCCTGTTTGTGAGGGGAAT
CGGGTCGTTAGGAATCAGGTTGAGACTAGTGCTACTATTGAGCCGGGGATGGGGAAGGGGACTAGGCTTGTTTTT
GAGAATGAAGCTGATGAGAGTCCGGACTGGATTGCTGGGGATTTGATTGTTGTTTTGGATGAGAAAGAGCCCGAG
CTTGGAGAGTCGGAGGAGGAGAGGACAGATGGGACGTTTTTCCGGCGGAAGGGGAAGGATCTGTTCTGGAAGGAG
AGTCTTTCGCTGCGCGAGGCGTGGATGGGTGACTGGAGTCGCAATCTTACGCATCTTGATGGGCACATTGTTCGT
CTTGGACGTGGTCGTGGTGAGGTCGTGCAGCCATTGGCTGTCGAGACTATTGCCGGGGAGGGCATGCCGCATTAC
TCCGAGGGTCATTTACATGATCACCATGAAGAGAATGATGAAGCGGGCAATCTGTTTATTGAGTATACTGTTGTC
CTGCCAGATCAGATGGAGAGTGGGATGGAGAAGGACTTCCATGCTCTTTGGGAGAAGTGGCGCAAGAAGATTGGA
GTTGATTTGGCGGAGGACTCTGGGCGACCGGTTGTGCCTCCGCCGGCGGAGGATAAGGATGAGCTGTGA
Gene >Pro_DTO377G3_2|g4182.t1
ATGCAATTATTACGACTCCTGGTCACACTAGCTGTAGTGCTATTCTCAGTTGTTGTAATCGCTGCTGAGGATTAC
TACAAGGTGCTTGGTCTCGCGAAGTCCGCGTCGGAGAGGGACATCAAGCGCGCATACAGAACACTAAGCAAGAAA
TACCACCCTGACAAGAATCCGTGAGTGGAGCTACTATTCTCTTATCTCTATTTTCATGCTTTCATTTCTCTACGT
GGCTCGCACATTACACTCGCACAAGGCAATTGCTAACCTTCCTCGCAGCGGCGATGACACAGCGCGCGAAAAATT
TGTCGAAATAGCAGACGCCTACGATGTGCTTTCGACCACCACGCTGCGCAAAGTGTACGACCAATATGGCCACGA
AGGGGTGGAGCAGCACCGCAAGGGCGGAGCGGCCGGCGGCGGCGGCCACGATCCATTCGATCTGTTTTCGCGATT
CTTCGGCGGGGGTGGACACTCCGGTCACGCGCCTGGACACCGCCGCGGACCGGACATGGAAGTGCGAGCGGCGCT
ACCGCTGCGGGATTTCTACAATGGGCGCGAGATCAACTTCCTCGTGGAGAAGCAGCAGATTTGCGATTCGTGTGA
GGGAACGGGATCCAAGGATCGACAGGTTGTGACTTGTGATCGGTGCGCAGGGCGTGGTATCGTTATTCAGAAACA
TATGCTTGCGCCGGGGATGTTCCAGCAAGTGCAGATGCAGTGTGACAAGTGTCATGGGCAGGGAAAGAAGATTAA
GAATCCTTGTCCTGTTTGTGAGGGGAATCGGGTCGTTAGGAATCAGGTTGAGACTAGTGCTACTATTGAGCCGGG
GATGGGGAAGGGGACTAGGCTTGTTTTTGAGAATGAAGCTGATGAGAGTCCGGACTGGATTGCTGGGGATTTGAT
TGTTGTTTTGGATGAGAAAGAGCCCGAGCTTGGAGAGTCGGAGGAGGAGAGGACAGATGGGACGTTTTTCCGGCG
GAAGGGGAAGGATCTGTTCTGGAAGGAGAGTCTTTCGCTGCGCGAGGCGTGGATGGGTGACTGGAGTCGCAATCT
TACGCATCTTGATGGGCACATTGTTCGTCTTGGACGTGGTCGTGGTGAGGTCGTGCAGCCATTGGCTGTCGAGAC
TATTGCCGGGGAGGGCATGCCGCATTACTCCGAGGGTCATTTACATGATCACCATGAAGAGAATGATGAAGCGGG
CAATCTGTTTATTGAGTATACTGTTGTCCTGCCAGATCAGATGGAGAGTGGGATGGAGAAGGACTTCCATGCTCT
TTGGGAGAAGTGGCGCAAGAAGATTGGAGTTGATTTGGCGGAGGACTCTGGGCGACCGGTTGTGCCTCCGCCGGC
GGAGGATAAGGATGAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail