Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g417.t1
Gene name
Locationscaffold_01:1059316..1060713
Strand-
Gene length (bp)1397
Transcript length (bp)1227
Coding sequence length (bp)1227
Protein length (aa) 409

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01062 Bestrophin Bestrophin, RFP-TM, chloride channel 1.0E-71 36 338

GO

GO Term Description Terminal node
GO:0005254 chloride channel activity Yes
GO:0015108 chloride transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0022803 passive transmembrane transporter activity No
GO:0005216 ion channel activity No
GO:0005253 anion channel activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015267 channel activity No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0015318 inorganic molecular entity transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

Domain # Start End Length
1 52 74 22
2 84 103 19
3 298 320 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g417.t1
MRLNFSEPPTPTLSRQNTTIQGHHERRGTHPHQLSSRTKPRRWPLVFRFIKGAIHGAILVPVLLHALFTALIVYL
DTFVFDTVGLPSTIIPSLSIVVGLMLVFRNQTSYNRFWDGRNGMNTLNTCVRNLVRTIATNSYNSKRGPPTAAER
EDIERTIRILMAIPYAVKNHLRAEWGAAWVFGNSVDEDLGIHPSTLYNPEYANLLPAGLEGHESEGLGLPFQLTF
FIDGFIKRGEERGWYPAPGASQMQAQLNTLTDAYGKMETIKLTPIPVAHLIHQKQVLALFGCVLPFAMVDEMGWW
AIPIVSLVIFTLYGIEGIGSQLEDPFGYDRNDIKMDAIVGDSKTEIDVVLSEWRRHSKAMEAFREQPVGAVHGDL
CLTPGRTESGNGRTDAKYTPPDLFLKLKPSTGR*
Coding >Pro_DTO377G3_2|g417.t1
ATGAGGTTAAATTTCAGCGAGCCGCCCACTCCGACCTTGAGCCGCCAAAACACTACAATACAAGGTCATCATGAA
CGGCGTGGCACTCATCCCCATCAGCTGTCATCACGGACAAAGCCAAGAAGATGGCCACTTGTTTTTCGCTTTATC
AAAGGTGCAATTCATGGCGCCATACTAGTCCCGGTCCTTCTGCATGCTTTGTTCACAGCCTTGATTGTTTACTTG
GATACCTTCGTATTCGACACTGTTGGTCTACCTAGCACTATCATCCCATCTTTATCTATTGTCGTAGGTCTGATG
CTTGTCTTCCGCAACCAAACATCCTACAATCGATTCTGGGACGGACGGAACGGAATGAACACACTTAATACATGC
GTGCGCAATCTCGTCCGCACGATCGCAACAAATAGCTACAATTCAAAGCGGGGACCGCCCACCGCCGCAGAGCGC
GAGGATATCGAGCGTACTATCCGCATTCTCATGGCTATCCCGTACGCCGTGAAAAACCATCTACGCGCCGAATGG
GGCGCTGCTTGGGTTTTTGGTAACTCCGTCGATGAGGACCTGGGCATACATCCATCTACCCTTTATAACCCCGAA
TATGCCAACTTGTTACCCGCGGGTCTTGAGGGTCATGAATCTGAGGGATTAGGCCTTCCATTCCAGTTGACCTTT
TTCATTGATGGGTTTATCAAGCGCGGCGAAGAACGTGGGTGGTATCCTGCTCCTGGCGCTAGTCAGATGCAGGCT
CAGTTGAATACCTTGACTGATGCATACGGGAAGATGGAAACGATCAAGTTGACTCCGATCCCAGTGGCTCACCTG
ATTCACCAAAAGCAAGTCCTCGCCCTGTTTGGCTGTGTTTTACCGTTCGCTATGGTCGATGAGATGGGATGGTGG
GCCATCCCAATTGTTAGCCTTGTTATCTTCACATTGTATGGAATTGAAGGAATAGGCTCGCAGTTGGAAGACCCC
TTTGGCTACGACAGAAATGACATCAAGATGGATGCTATTGTCGGTGACTCCAAGACTGAAATCGATGTTGTTTTG
TCTGAGTGGCGCAGGCATTCGAAGGCCATGGAGGCATTCAGAGAACAGCCCGTTGGTGCAGTTCATGGTGATCTA
TGTTTAACGCCCGGTCGAACTGAATCTGGAAACGGAAGGACGGACGCGAAGTATACACCCCCAGACTTGTTCTTG
AAGTTGAAGCCGAGTACTGGTAGGTGA
Transcript >Pro_DTO377G3_2|g417.t1
ATGAGGTTAAATTTCAGCGAGCCGCCCACTCCGACCTTGAGCCGCCAAAACACTACAATACAAGGTCATCATGAA
CGGCGTGGCACTCATCCCCATCAGCTGTCATCACGGACAAAGCCAAGAAGATGGCCACTTGTTTTTCGCTTTATC
AAAGGTGCAATTCATGGCGCCATACTAGTCCCGGTCCTTCTGCATGCTTTGTTCACAGCCTTGATTGTTTACTTG
GATACCTTCGTATTCGACACTGTTGGTCTACCTAGCACTATCATCCCATCTTTATCTATTGTCGTAGGTCTGATG
CTTGTCTTCCGCAACCAAACATCCTACAATCGATTCTGGGACGGACGGAACGGAATGAACACACTTAATACATGC
GTGCGCAATCTCGTCCGCACGATCGCAACAAATAGCTACAATTCAAAGCGGGGACCGCCCACCGCCGCAGAGCGC
GAGGATATCGAGCGTACTATCCGCATTCTCATGGCTATCCCGTACGCCGTGAAAAACCATCTACGCGCCGAATGG
GGCGCTGCTTGGGTTTTTGGTAACTCCGTCGATGAGGACCTGGGCATACATCCATCTACCCTTTATAACCCCGAA
TATGCCAACTTGTTACCCGCGGGTCTTGAGGGTCATGAATCTGAGGGATTAGGCCTTCCATTCCAGTTGACCTTT
TTCATTGATGGGTTTATCAAGCGCGGCGAAGAACGTGGGTGGTATCCTGCTCCTGGCGCTAGTCAGATGCAGGCT
CAGTTGAATACCTTGACTGATGCATACGGGAAGATGGAAACGATCAAGTTGACTCCGATCCCAGTGGCTCACCTG
ATTCACCAAAAGCAAGTCCTCGCCCTGTTTGGCTGTGTTTTACCGTTCGCTATGGTCGATGAGATGGGATGGTGG
GCCATCCCAATTGTTAGCCTTGTTATCTTCACATTGTATGGAATTGAAGGAATAGGCTCGCAGTTGGAAGACCCC
TTTGGCTACGACAGAAATGACATCAAGATGGATGCTATTGTCGGTGACTCCAAGACTGAAATCGATGTTGTTTTG
TCTGAGTGGCGCAGGCATTCGAAGGCCATGGAGGCATTCAGAGAACAGCCCGTTGGTGCAGTTCATGGTGATCTA
TGTTTAACGCCCGGTCGAACTGAATCTGGAAACGGAAGGACGGACGCGAAGTATACACCCCCAGACTTGTTCTTG
AAGTTGAAGCCGAGTACTGGTAGGTGA
Gene >Pro_DTO377G3_2|g417.t1
ATGAGGTTAAATTTCAGCGAGCCGCCCACTCCGACCTTGAGCCGCCAAAACACTACAATACAAGGTCATCATGAA
CGGCGTGGCACTCATCCCCATCAGCTGTCATCACGGACAAAGCCAAGAAGGTGAGCTATCTAATCGGTATATGCC
AATTATCCGCATGAGCTAATATCGAGCAGATGGCCACTTGTTTTTCGCTTTATCAAAGGTGCAATTCATGGCGCC
ATACTAGTCCCGGTCCTTCTGCATGCTTTGTTCACAGCCTTGATTGTTTACTTGGATACCTTCGTATTCGACACT
GTTGGTCTACCTAGCACTATCGTATGTACCCCCAACCAATAAGACGAGACAGCAACTAAACATATCAAAAACAGA
TCCCATCTTTATCTATTGTCGTAGGTCTGATGCTTGTCTTCCGCAACCAAACATCCTACAATCGATTCTGGGACG
GACGGAACGGAATGAACACACTTAATACATGCGTGCGCAATCTCGTCCGCACGATCGCAACAAATAGCTACAATT
CAAAGCGGGGACCGCCCACCGCCGCAGAGCGCGAGGATATCGAGCGTACTATCCGCATTCTCATGGCTATCCCGT
ACGCCGTGAAAAACCATCTACGCGCCGAATGGGGCGCTGCTTGGGTTTTTGGTAACTCCGTCGATGAGGACCTGG
GCATACATCCATCTACCCTTTATAACCCCGAATATGCCAACTTGTTACCCGCGGGTCTTGAGGGTCATGAATCTG
AGGGATTAGGCCTTCCATTCCAGTTGACCTTTTTCATTGATGGGTTTATCAAGCGCGGCGAAGAACGTGGGTGGT
ATCCTGCTCCTGGCGCTAGTCAGATGCAGGCTCAGTTGAATACCTTGACTGATGCATACGGGAAGATGGAAACGA
TCAAGTTGACTCCGATCCCAGTGGCTCACCTGTAAGATTCATGACTAATGCGTGTCGAGTTAAGTTTTATATTTC
AAATACTGACTCAAATTAGGATTCACCAAAAGCAAGTCCTCGCCCTGTTTGGCTGTGTTTTACCGTTCGCTATGG
TCGATGAGATGGGATGGTGGGCCATCCCAATTGTTAGCCTTGTTATCTTCACATTGTATGGAATTGAAGGAATAG
GCTCGCAGTTGGAAGACCCCTTTGGCTACGACAGAAATGACATCAAGATGGATGCTATTGTCGGTGACTCCAAGA
CTGAAATCGATGTTGTTTTGTCTGAGTGGCGCAGGCATTCGAAGGCCATGGAGGCATTCAGAGAACAGCCCGTTG
GTGCAGTTCATGGTGATCTATGTTTAACGCCCGGTCGAACTGAATCTGGAAACGGAAGGACGGACGCGAAGTATA
CACCCCCAGACTTGTTCTTGAAGTTGAAGCCGAGTACTGGTAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail