Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4164.t1
Gene name
Locationscaffold_08:228841..231587
Strand-
Gene length (bp)2746
Transcript length (bp)2490
Coding sequence length (bp)2490
Protein length (aa) 830

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12868 DUF3824 Domain of unknwon function (DUF3824) 1.0E-33 493 646
PF12868 DUF3824 Domain of unknwon function (DUF3824) 4.5E-01 713 786

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4164.t1
MSYTYRERERDWDETRPVSIKRYVISPEDDRRDFMSRHDDSFGGEREVVIRRKTDREEPVTVSRYEREVEYEPPT
RYERDYDSRIYTSPRESEYDVVRRSEVDEDPYYYNRHRRVREYDEARSRRELSPDDSVSQSSRRHRGDRDQDYSS
DDSMVYIRKETRDYDDHPHHRRHLAEGALVGVGAAELLRNHNKKDGEVSHGASRIGRTIGAGALGAVAVSAASHA
RDYYRSKSRHRSHSFEDDRSSHRHSRHGRSRHSRSRSRSQSHSRAKTLLELGVGAAAVAAGVAALRSKSKADERK
SRSRTRSRSRVSSRGRSEKDGEQGKRSMSERRKHMAEAGLAGAAVAGLVEKVRSQSRSRKGERSRSRLRQALPIV
AAGLATAAATGLYEKQKSDKDEKEGSSRGRHRSRSHSRAPSQSYPDPTRDSAGLIEYGNDPVAGSIPSEHYYGQP
DAPYYDEQEAYGPRRHPRSRSRSRSRVRYSSSSSSDGEGHRRRHRSRSRDLAGAALGATGLGYAAHKYNERRKSR
ERDREHSTHDDNVHRDPYEESYNPEPYPLSPQAAPSAPPMPDPHYYPSNPNPNPNPNPNYYPPPPGDSTYNLNST
PASYNPADYPPPPGAAPPQPYAYGAAPPGPGPEQYTHRPRRAEDNVRPLPIDANHAHKGLNIHPFPTSAPRSISQ
PPKSVAFDLTDPPHDPGYETDDSDSTVGSGSSSHRGGRDHRHDRDRDRDRDRDRDSRHHHHRRSSSVPYPPMPPP
SSTASDRHNFYPDSSHHRHHPSAPKHHEERDQNKAPEADSDSTIDLPSRFDGQGRPLPERDPAVDKFEDLVNRFT
KVLF*
Coding >Pro_DTO377G3_2|g4164.t1
ATGTCGTACACTTACAGAGAACGCGAACGAGACTGGGATGAAACCCGTCCTGTGTCAATCAAGCGTTACGTCATT
TCTCCCGAAGACGACCGTCGAGACTTCATGTCGAGACACGATGACTCCTTTGGCGGCGAGCGCGAGGTGGTGATC
CGGCGCAAAACGGATCGTGAAGAGCCTGTGACCGTCTCGCGCTACGAGCGAGAGGTGGAGTATGAGCCACCCACA
CGCTATGAGAGAGACTATGATTCCCGCATTTATACTAGTCCCCGTGAATCCGAGTATGATGTCGTGCGCCGCTCT
GAGGTGGACGAGGACCCGTATTATTACAACCGTCACCGTCGAGTCCGCGAGTACGACGAAGCTCGCTCCCGGCGT
GAGCTGAGCCCTGATGATTCCGTTTCCCAGAGTAGTCGCCGCCACCGCGGCGATCGTGATCAGGACTACAGCAGC
GATGACAGTATGGTCTACATCCGAAAGGAAACCCGCGATTATGACGACCACCCTCACCACCGTCGCCATCTCGCA
GAGGGTGCATTGGTAGGTGTTGGCGCGGCTGAATTGCTCCGAAACCACAACAAAAAAGATGGCGAAGTCAGCCAT
GGCGCCAGCCGTATTGGTAGGACTATTGGTGCCGGGGCTCTTGGTGCAGTCGCTGTGAGTGCTGCATCGCATGCT
CGTGACTACTACCGTAGTAAGAGCCGTCACCGTTCTCATTCCTTTGAAGATGACCGTTCTTCCCATCGTCACAGC
AGACATGGCCGGAGTCGCCACAGCCGCAGCCGCAGCCGCTCTCAATCGCACTCTCGTGCAAAGACTTTGCTCGAG
CTGGGAGTTGGTGCCGCAGCCGTGGCTGCTGGTGTGGCTGCACTGCGTAGCAAGTCAAAAGCTGATGAGCGCAAA
AGCCGGTCTCGCACTCGCTCCCGTTCTCGGGTTTCTAGCCGTGGTCGCTCGGAGAAGGATGGGGAACAAGGCAAA
CGCAGCATGTCTGAGCGCCGCAAGCACATGGCTGAGGCTGGATTGGCTGGTGCGGCCGTGGCTGGCCTGGTTGAA
AAGGTCCGCAGCCAGTCGCGCTCTCGAAAGGGTGAGCGCTCCCGATCCCGCCTGAGACAAGCTCTTCCCATTGTG
GCTGCCGGTCTTGCCACTGCTGCTGCCACCGGTCTCTACGAGAAGCAGAAGAGTGACAAAGATGAAAAGGAGGGC
TCGAGCCGGGGCCGCCATCGCTCAAGGTCTCACAGCCGCGCCCCGTCACAGTCCTATCCCGATCCAACTCGCGAC
TCGGCCGGCCTGATCGAATACGGCAACGACCCAGTCGCAGGTAGCATCCCATCTGAGCATTACTACGGTCAGCCT
GATGCGCCCTACTACGATGAACAGGAAGCCTATGGCCCCAGACGCCATCCCCGCAGTCGCAGTCGCAGTCGTAGC
CGAGTCCGCTACAGCAGTTCATCCAGTTCTGACGGCGAAGGTCACCGCCGACGGCATCGCAGCCGCTCACGAGAC
CTCGCGGGGGCCGCACTAGGCGCAACAGGTCTCGGTTATGCCGCCCACAAGTACAACGAGCGTCGCAAGTCCAGA
GAGCGCGATCGCGAACACTCCACGCATGACGACAACGTGCACCGTGATCCTTATGAAGAATCCTACAATCCAGAG
CCATACCCGCTTTCCCCGCAGGCGGCCCCAAGTGCCCCGCCCATGCCTGACCCCCACTACTACCCCAGCAACCCC
AACCCCAACCCCAACCCCAACCCCAACTACTACCCCCCGCCCCCGGGCGACTCAACCTACAACCTGAACAGCACC
CCCGCTTCATACAATCCAGCAGACTACCCTCCACCACCCGGTGCTGCGCCACCTCAGCCTTATGCCTACGGCGCT
GCGCCACCAGGACCGGGACCCGAGCAGTACACACATCGGCCGCGTAGGGCTGAAGACAATGTGAGACCCCTACCT
ATTGATGCAAACCACGCACACAAGGGTCTGAACATCCACCCATTCCCAACGTCTGCCCCCCGGTCAATTAGCCAA
CCGCCGAAATCTGTCGCGTTCGACTTGACGGATCCTCCGCACGATCCTGGCTACGAGACCGATGACAGTGACTCT
ACCGTTGGATCGGGTTCGTCTTCGCATCGCGGAGGTAGAGACCACCGTCACGATCGAGATCGAGATCGAGATCGT
GACCGTGACCGTGATAGCCGTCATCATCATCATCGCCGCTCCTCATCCGTGCCCTATCCACCTATGCCCCCTCCT
TCTTCTACTGCCTCAGACCGTCACAATTTCTATCCTGATTCTAGTCACCATCGACATCACCCATCAGCCCCGAAA
CACCACGAGGAAAGAGACCAGAACAAAGCCCCTGAAGCAGACTCCGACTCAACCATCGACCTACCCAGCCGCTTT
GATGGGCAAGGCCGCCCTCTTCCCGAGCGGGATCCCGCTGTGGATAAATTTGAGGACCTGGTGAATAGGTTTACC
AAGGTTCTGTTCTAG
Transcript >Pro_DTO377G3_2|g4164.t1
ATGTCGTACACTTACAGAGAACGCGAACGAGACTGGGATGAAACCCGTCCTGTGTCAATCAAGCGTTACGTCATT
TCTCCCGAAGACGACCGTCGAGACTTCATGTCGAGACACGATGACTCCTTTGGCGGCGAGCGCGAGGTGGTGATC
CGGCGCAAAACGGATCGTGAAGAGCCTGTGACCGTCTCGCGCTACGAGCGAGAGGTGGAGTATGAGCCACCCACA
CGCTATGAGAGAGACTATGATTCCCGCATTTATACTAGTCCCCGTGAATCCGAGTATGATGTCGTGCGCCGCTCT
GAGGTGGACGAGGACCCGTATTATTACAACCGTCACCGTCGAGTCCGCGAGTACGACGAAGCTCGCTCCCGGCGT
GAGCTGAGCCCTGATGATTCCGTTTCCCAGAGTAGTCGCCGCCACCGCGGCGATCGTGATCAGGACTACAGCAGC
GATGACAGTATGGTCTACATCCGAAAGGAAACCCGCGATTATGACGACCACCCTCACCACCGTCGCCATCTCGCA
GAGGGTGCATTGGTAGGTGTTGGCGCGGCTGAATTGCTCCGAAACCACAACAAAAAAGATGGCGAAGTCAGCCAT
GGCGCCAGCCGTATTGGTAGGACTATTGGTGCCGGGGCTCTTGGTGCAGTCGCTGTGAGTGCTGCATCGCATGCT
CGTGACTACTACCGTAGTAAGAGCCGTCACCGTTCTCATTCCTTTGAAGATGACCGTTCTTCCCATCGTCACAGC
AGACATGGCCGGAGTCGCCACAGCCGCAGCCGCAGCCGCTCTCAATCGCACTCTCGTGCAAAGACTTTGCTCGAG
CTGGGAGTTGGTGCCGCAGCCGTGGCTGCTGGTGTGGCTGCACTGCGTAGCAAGTCAAAAGCTGATGAGCGCAAA
AGCCGGTCTCGCACTCGCTCCCGTTCTCGGGTTTCTAGCCGTGGTCGCTCGGAGAAGGATGGGGAACAAGGCAAA
CGCAGCATGTCTGAGCGCCGCAAGCACATGGCTGAGGCTGGATTGGCTGGTGCGGCCGTGGCTGGCCTGGTTGAA
AAGGTCCGCAGCCAGTCGCGCTCTCGAAAGGGTGAGCGCTCCCGATCCCGCCTGAGACAAGCTCTTCCCATTGTG
GCTGCCGGTCTTGCCACTGCTGCTGCCACCGGTCTCTACGAGAAGCAGAAGAGTGACAAAGATGAAAAGGAGGGC
TCGAGCCGGGGCCGCCATCGCTCAAGGTCTCACAGCCGCGCCCCGTCACAGTCCTATCCCGATCCAACTCGCGAC
TCGGCCGGCCTGATCGAATACGGCAACGACCCAGTCGCAGGTAGCATCCCATCTGAGCATTACTACGGTCAGCCT
GATGCGCCCTACTACGATGAACAGGAAGCCTATGGCCCCAGACGCCATCCCCGCAGTCGCAGTCGCAGTCGTAGC
CGAGTCCGCTACAGCAGTTCATCCAGTTCTGACGGCGAAGGTCACCGCCGACGGCATCGCAGCCGCTCACGAGAC
CTCGCGGGGGCCGCACTAGGCGCAACAGGTCTCGGTTATGCCGCCCACAAGTACAACGAGCGTCGCAAGTCCAGA
GAGCGCGATCGCGAACACTCCACGCATGACGACAACGTGCACCGTGATCCTTATGAAGAATCCTACAATCCAGAG
CCATACCCGCTTTCCCCGCAGGCGGCCCCAAGTGCCCCGCCCATGCCTGACCCCCACTACTACCCCAGCAACCCC
AACCCCAACCCCAACCCCAACCCCAACTACTACCCCCCGCCCCCGGGCGACTCAACCTACAACCTGAACAGCACC
CCCGCTTCATACAATCCAGCAGACTACCCTCCACCACCCGGTGCTGCGCCACCTCAGCCTTATGCCTACGGCGCT
GCGCCACCAGGACCGGGACCCGAGCAGTACACACATCGGCCGCGTAGGGCTGAAGACAATGTGAGACCCCTACCT
ATTGATGCAAACCACGCACACAAGGGTCTGAACATCCACCCATTCCCAACGTCTGCCCCCCGGTCAATTAGCCAA
CCGCCGAAATCTGTCGCGTTCGACTTGACGGATCCTCCGCACGATCCTGGCTACGAGACCGATGACAGTGACTCT
ACCGTTGGATCGGGTTCGTCTTCGCATCGCGGAGGTAGAGACCACCGTCACGATCGAGATCGAGATCGAGATCGT
GACCGTGACCGTGATAGCCGTCATCATCATCATCGCCGCTCCTCATCCGTGCCCTATCCACCTATGCCCCCTCCT
TCTTCTACTGCCTCAGACCGTCACAATTTCTATCCTGATTCTAGTCACCATCGACATCACCCATCAGCCCCGAAA
CACCACGAGGAAAGAGACCAGAACAAAGCCCCTGAAGCAGACTCCGACTCAACCATCGACCTACCCAGCCGCTTT
GATGGGCAAGGCCGCCCTCTTCCCGAGCGGGATCCCGCTGTGGATAAATTTGAGGACCTGGTGAATAGGTTTACC
AAGGTTCTGTTCTAG
Gene >Pro_DTO377G3_2|g4164.t1
ATGTCGTACACTTACAGAGAACGCGAACGAGACTGGGATGAAACCCGTCCTGTGTCAATCAAGCGTTACGTCATT
TCTCCCGAAGACGACCGTCGAGACTTCATGTCGAGACACGATGACTCCTTTGGCGGCGAGCGCGAGGTGGTGATC
CGGCGCAAAACGGATCGTGAAGAGCCTGTGACCGTCTCGCGCTACGAGCGAGAGGTGGAGTATGAGCCACCCACA
CGCTATGAGAGAGACTATGATTGTGAGTACCCTACATCCCCACACCAATCGACCACACTTCCAATCCATGGATTT
CCCTGGACCGAGTGGAGCTGTCCCCTACTGCTACTACCATGTCCACCCCAAAACAACCCGTACTTATTCGTGAAG
CCCGCATTTATACTAGTCCCCGTGAATCCGAGTATGATGTCGTGCGCCGCTCTGAGGTGGACGAGGACCCGTATT
ATTACAACCGTCACCGTCGAGTCCGCGAGTACGACGAAGCTCGCTCCCGGCGTGAGCTGAGCCCTGATGATTCCG
TTTCCCAGAGTAGTCGCCGCCACCGCGGCGATCGTGATCAGGACTACAGCAGCGATGACAGTATGGTCTACATCC
GAAAGGAAACCCGCGATTATGACGACCACCCTCACCACCGTCGCCATCTCGCAGAGGGTGCATTGGTAGGTGTTG
GCGCGGCTGAATTGCTCCGAAACCACAACAAAAAAGATGGCGAAGTCAGCCATGGCGCCAGCCGTATTGGTAGGA
CTATTGGTGCCGGGGCTCTTGGTGCAGTCGCTGTGAGTGCTGCATCGCATGCTCGTGACTACTACCGTAGTAAGA
GCCGTCACCGTTCTCATTCCTTTGAAGATGACCGTTCTTCCCATCGTCACAGCAGACATGGCCGGAGTCGCCACA
GCCGCAGCCGCAGCCGCTCTCAATCGCACTCTCGTGCAAAGACTTTGCTCGAGCTGGGAGTTGGTGCCGCAGCCG
TGGCTGCTGGTGTGGCTGCACTGCGTAGCAAGTCAAAAGCTGATGAGCGCAAAAGCCGGTCTCGCACTCGCTCCC
GTTCTCGGGTTTCTAGCCGTGGTCGCTCGGAGAAGGATGGGGAACAAGGCAAACGCAGCATGTCTGAGCGCCGCA
AGCACATGGCTGAGGCTGGATTGGCTGGTGCGGCCGTGGCTGGCCTGGTTGAAAAGGTCCGCAGCCAGTCGCGCT
CTCGAAAGGGTGAGCGCTCCCGATCCCGCCTGAGACAAGCTCTTCCCATTGTGGCTGCCGGTCTTGCCACTGCTG
CTGCCACCGGTCTCTACGAGAAGCAGAAGAGTGACAAAGATGAAAAGGAGGGCTCGAGCCGGGGCCGCCATCGCT
CAAGGTCTCACAGCCGCGCCCCGTCACAGTCCTATCCCGATCCAACTCGCGACTCGGCCGGCCTGATCGAATACG
GCAACGACCCAGTCGCAGGTAGCATCCCATCTGAGCATTACTACGGTCAGCCTGATGCGCCCTACTACGATGAAC
AGGAAGCCTATGGCCCCAGACGCCATCCCCGCAGTCGCAGTCGCAGTCGTAGCCGAGTCCGCTACAGCAGTTCAT
CCAGTTCTGACGGCGAAGGTCACCGCCGACGGCATCGCAGCCGCTCACGAGACCTCGCGGGGGCCGCACTAGGCG
CAACAGGTCTCGGTTATGCCGCCCACAAGTACAACGAGCGTCGCAAGTCCAGAGAGCGCGATCGCGAACACTCCA
GTAAGTCCCCACTTCATCAAATTCCTACCGAGAAATATTTACCCTGACTAGTGGTGTAATCAGCGCATGACGACA
ACGTGCACCGTGATCCTTATGAAGAATCCTACAATCCAGAGCCATACCCGCTTTCCCCGCAGGCGGCCCCAAGTG
CCCCGCCCATGCCTGACCCCCACTACTACCCCAGCAACCCCAACCCCAACCCCAACCCCAACCCCAACTACTACC
CCCCGCCCCCGGGCGACTCAACCTACAACCTGAACAGCACCCCCGCTTCATACAATCCAGCAGACTACCCTCCAC
CACCCGGTGCTGCGCCACCTCAGCCTTATGCCTACGGCGCTGCGCCACCAGGACCGGGACCCGAGCAGTACACAC
ATCGGCCGCGTAGGGCTGAAGACAATGTGAGACCCCTACCTATTGATGCAAACCACGCACACAAGGGTGGGTTCG
GCGGACCACAACTGTGACTGTATAGAATGTAATCAAAGCTGATCCTTAATCGATAGGTCTGAACATCCACCCATT
CCCAACGTCTGCCCCCCGGTCAATTAGCCAACCGCCGAAATCTGTCGCGTTCGACTTGACGGATCCTCCGCACGA
TCCTGGCTACGAGACCGATGACAGTGACTCTACCGTTGGATCGGGTTCGTCTTCGCATCGCGGAGGTAGAGACCA
CCGTCACGATCGAGATCGAGATCGAGATCGTGACCGTGACCGTGATAGCCGTCATCATCATCATCGCCGCTCCTC
ATCCGTGCCCTATCCACCTATGCCCCCTCCTTCTTCTACTGCCTCAGACCGTCACAATTTCTATCCTGATTCTAG
TCACCATCGACATCACCCATCAGCCCCGAAACACCACGAGGAAAGAGACCAGAACAAAGCCCCTGAAGCAGACTC
CGACTCAACCATCGACCTACCCAGCCGCTTTGATGGGCAAGGCCGCCCTCTTCCCGAGCGGGATCCCGCTGTGGA
TAAATTTGAGGACCTGGTGAATAGGTTTACCAAGGTTCTGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail