Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4162.t1
Gene name
Locationscaffold_08:220285..223279
Strand+
Gene length (bp)2994
Transcript length (bp)2814
Coding sequence length (bp)2814
Protein length (aa) 938

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 6.3E-38 618 932

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0030001 metal ion transport Yes
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0008324 cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 909 928 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 80.74 49.00 112.49
5d_25C Five days - 25 degrees Celsius 95.74 57.50 133.97
7d_25C Seven days - 25 degrees Celsius 98.76 58.86 138.65
10d_25C Ten days - 25 degrees Celsius 107.85 64.21 151.50
7d_15C Seven days - 15 degrees Celsius 147.91 83.86 211.96
7d_30C Seven days - 30 degrees Celsius 71.51 42.40 100.62

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.506685 no
3d_25C 7d_25C 0.423452 no
3d_25C 7d_15C 0.004045 yes
3d_25C 7d_30C 0.670545 no
3d_25C 10d_25C 0.205831 no
5d_25C 7d_25C 0.928749 no
5d_25C 7d_15C 0.052372 no
5d_25C 7d_30C 0.208758 no
5d_25C 10d_25C 0.679724 no
7d_25C 7d_15C 0.080003 no
7d_25C 7d_30C 0.170024 no
7d_25C 10d_25C 0.776122 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.186536 no
7d_30C 10d_25C 0.064014 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4162.t1
MAPPMIPTPGIAASRPPRSSHSSSRPQHSDYPPDADNNASYGPMGGGRAPGTSSPVPVSETTPANNTRFIPPADY
AAGKPSKSSKRKKNRNRKRRNRHQSFIPPSREESHDIPGETSDAGGVRDSMEADRPTSRDKSFFKLGRNLSNTSL
ESDALLDHRDQPLMRPRRDSRVASSFRPSSLTSNVFRSNDGQSRSTPRGGRGQQHHNGDSDEEDANDRTPLMRPV
SSHTPGNNWYGTDNRPNLFSSRARQYSTRTMSSGCSPKDDRSPLYSPTVERDYDVNNPPSIPGSPKLGPEMNYDD
AVVTGADWDFSLARTMENHRESMNALNDTLIDIDGNGLHSHSAPSSSPGSPLLSPHQELRRRRTVTLPAQEDVCF
PTETISELGDEGARQIPDEAGERRRRRHRRWPDLSALEEWSREEKEERNGDNRVKRISEPMLIAGRLRPQYTGWR
REEDEAPYRFTYFNEEFPSTIHAQTISELVQPGGSFRDLFIPDPPELEDSSEDEDSEEESFMEHAALNHSTNPAN
KPIYHTDNQSQGQGHQTSVNPCMTPQTVVPNGRTANDPMTGNAPPVRGPSRLSVISEGHPDSHRELSPAPSNTPF
SKTPNPKPKRYGPRPTFWLDVLSPTDAEMRTIAKAFGIHALTTEDIMMQEAREKVELFRSYYFVNYRTFEQDTNS
EDYLEPVNMYVVVFREGVISFHFSQTPHPANVRRRIRQLMDYLILSSDWISYALIDDITDVFGPLIQAIENEVDE
IDEMIMKMHSASKEVSSNDSVLPSFAPGDMLRRVGECRKKVMGLYRLLSNKADVVKGFSKRCNEQWEVAPKSEIG
LYLGDIQDHIMTMTGNLTHYETILSRAHSNYLAQINILMNERQEHTADVLGKLTVLGTIVLPMNIICGMWGMNVK
VPGQEIDSLTWFWCITAGLCVFAFVSVWTAKRVYKIV*
Coding >Pro_DTO377G3_2|g4162.t1
ATGGCTCCGCCCATGATCCCAACACCTGGCATAGCGGCCTCCCGACCGCCTCGTTCCTCGCATTCGTCTAGCCGT
CCACAGCACAGCGATTATCCACCCGACGCTGATAACAACGCTAGCTATGGCCCAATGGGCGGCGGTCGGGCTCCA
GGGACTAGTAGTCCGGTACCCGTCTCGGAGACCACGCCAGCCAACAATACCCGCTTCATCCCCCCCGCTGATTAT
GCTGCTGGCAAACCCTCCAAGTCCTCCAAGCGCAAAAAGAACCGCAATCGCAAACGTCGCAATCGACACCAGTCT
TTTATTCCACCTAGCCGGGAGGAATCTCATGATATTCCTGGGGAGACTTCGGATGCTGGAGGTGTTAGAGATTCA
ATGGAGGCCGACCGGCCAACCTCGAGGGACAAGTCGTTCTTCAAATTGGGACGCAATCTGAGTAACACAAGCTTG
GAGAGCGATGCGTTGTTAGACCATCGGGACCAACCTTTGATGCGACCTCGTCGTGACAGTCGCGTTGCATCGTCA
TTCCGGCCGAGCTCCCTAACATCCAATGTCTTCCGATCGAACGATGGGCAATCTCGCAGCACCCCGAGGGGAGGA
CGGGGCCAACAACATCACAATGGTGATAGTGACGAAGAGGATGCCAATGATCGGACCCCATTGATGCGGCCAGTT
TCCAGTCACACGCCCGGCAATAATTGGTATGGAACGGACAATCGCCCGAATTTGTTCTCCTCACGTGCTCGACAG
TACTCTACTCGGACTATGTCCTCCGGCTGTTCACCAAAGGATGATCGCAGCCCACTCTATTCTCCCACTGTGGAG
CGAGACTACGATGTCAACAACCCGCCGTCCATTCCCGGGTCCCCAAAGCTGGGCCCGGAGATGAATTATGACGAT
GCCGTGGTAACAGGAGCTGATTGGGACTTCTCGTTAGCTCGGACAATGGAGAATCACCGGGAGTCTATGAACGCC
TTGAACGACACGCTGATCGACATAGACGGGAATGGATTGCACTCACATTCTGCGCCATCTTCTTCGCCTGGGTCG
CCGCTTCTCTCTCCTCACCAAGAATTACGGCGGCGCCGGACCGTGACATTACCAGCACAGGAAGATGTATGCTTC
CCCACCGAAACGATATCCGAATTGGGAGACGAGGGAGCGAGACAAATTCCTGATGAAGCCGGCGAACGTCGACGG
CGTAGACACCGGCGATGGCCCGATCTCTCCGCCCTGGAAGAATGGAGCCGTGAGGAAAAAGAGGAGCGCAATGGA
GACAATCGAGTCAAAAGGATCAGTGAGCCTATGCTCATCGCAGGCCGATTGCGCCCTCAGTATACAGGATGGCGA
CGTGAAGAGGATGAGGCGCCTTATCGGTTCACATATTTCAACGAGGAATTTCCGAGCACCATTCATGCTCAAACC
ATCTCTGAGCTGGTACAGCCAGGTGGTAGCTTCCGCGATTTGTTTATTCCAGATCCTCCCGAATTGGAAGATTCG
TCTGAAGACGAGGACTCGGAAGAGGAATCTTTTATGGAGCATGCAGCTCTCAATCACTCAACCAATCCCGCCAAC
AAGCCAATATATCACACAGACAATCAAAGTCAAGGCCAAGGCCATCAAACGAGCGTTAATCCTTGTATGACACCT
CAGACCGTTGTTCCCAACGGAAGAACTGCAAATGACCCTATGACTGGCAATGCTCCTCCGGTCAGAGGACCCTCG
CGTTTATCTGTCATCAGCGAAGGACACCCAGACTCCCACCGTGAGCTCTCGCCCGCACCTTCCAACACCCCTTTT
AGCAAAACCCCCAATCCGAAACCTAAACGCTACGGTCCACGGCCGACTTTCTGGCTAGATGTCCTCTCCCCGACA
GATGCAGAGATGCGTACGATTGCCAAAGCTTTTGGGATTCACGCATTGACGACAGAGGACATTATGATGCAAGAA
GCTCGAGAGAAAGTCGAGTTATTTCGCAGCTACTATTTCGTCAACTACCGTACTTTTGAGCAGGATACCAACAGC
GAGGACTATCTCGAGCCAGTGAACATGTATGTGGTGGTTTTCCGCGAAGGCGTGATCTCCTTCCATTTTTCGCAA
ACACCTCACCCAGCCAATGTTCGGCGGCGTATCCGCCAACTGATGGATTACCTGATCCTCAGCTCAGACTGGATT
TCATACGCACTGATTGATGACATTACCGATGTCTTCGGTCCGCTGATTCAAGCGATTGAAAATGAGGTCGATGAG
ATCGACGAGATGATCATGAAAATGCACTCTGCCAGCAAGGAGGTGTCGTCCAATGACAGTGTGCTTCCTTCATTC
GCACCAGGAGATATGCTGCGGCGAGTGGGAGAATGCCGCAAGAAGGTCATGGGACTGTACCGACTTCTCAGCAAC
AAGGCCGATGTAGTCAAGGGCTTTTCCAAGCGTTGCAATGAGCAGTGGGAGGTTGCCCCCAAGTCGGAGATTGGC
CTGTACCTCGGTGACATTCAGGATCACATCATGACGATGACTGGTAACCTAACGCACTACGAAACAATCCTTTCC
CGTGCACACTCCAATTATTTGGCGCAGATCAACATCCTCATGAACGAGCGTCAGGAACATACTGCCGATGTCCTG
GGTAAGCTGACTGTTCTTGGTACGATTGTCCTACCGATGAACATCATCTGCGGCATGTGGGGGATGAACGTGAAG
GTACCAGGTCAGGAAATCGATAGCCTTACATGGTTCTGGTGCATTACCGCCGGACTATGCGTATTTGCATTTGTA
TCTGTTTGGACTGCTAAAAGAGTCTACAAAATTGTATAG
Transcript >Pro_DTO377G3_2|g4162.t1
ATGGCTCCGCCCATGATCCCAACACCTGGCATAGCGGCCTCCCGACCGCCTCGTTCCTCGCATTCGTCTAGCCGT
CCACAGCACAGCGATTATCCACCCGACGCTGATAACAACGCTAGCTATGGCCCAATGGGCGGCGGTCGGGCTCCA
GGGACTAGTAGTCCGGTACCCGTCTCGGAGACCACGCCAGCCAACAATACCCGCTTCATCCCCCCCGCTGATTAT
GCTGCTGGCAAACCCTCCAAGTCCTCCAAGCGCAAAAAGAACCGCAATCGCAAACGTCGCAATCGACACCAGTCT
TTTATTCCACCTAGCCGGGAGGAATCTCATGATATTCCTGGGGAGACTTCGGATGCTGGAGGTGTTAGAGATTCA
ATGGAGGCCGACCGGCCAACCTCGAGGGACAAGTCGTTCTTCAAATTGGGACGCAATCTGAGTAACACAAGCTTG
GAGAGCGATGCGTTGTTAGACCATCGGGACCAACCTTTGATGCGACCTCGTCGTGACAGTCGCGTTGCATCGTCA
TTCCGGCCGAGCTCCCTAACATCCAATGTCTTCCGATCGAACGATGGGCAATCTCGCAGCACCCCGAGGGGAGGA
CGGGGCCAACAACATCACAATGGTGATAGTGACGAAGAGGATGCCAATGATCGGACCCCATTGATGCGGCCAGTT
TCCAGTCACACGCCCGGCAATAATTGGTATGGAACGGACAATCGCCCGAATTTGTTCTCCTCACGTGCTCGACAG
TACTCTACTCGGACTATGTCCTCCGGCTGTTCACCAAAGGATGATCGCAGCCCACTCTATTCTCCCACTGTGGAG
CGAGACTACGATGTCAACAACCCGCCGTCCATTCCCGGGTCCCCAAAGCTGGGCCCGGAGATGAATTATGACGAT
GCCGTGGTAACAGGAGCTGATTGGGACTTCTCGTTAGCTCGGACAATGGAGAATCACCGGGAGTCTATGAACGCC
TTGAACGACACGCTGATCGACATAGACGGGAATGGATTGCACTCACATTCTGCGCCATCTTCTTCGCCTGGGTCG
CCGCTTCTCTCTCCTCACCAAGAATTACGGCGGCGCCGGACCGTGACATTACCAGCACAGGAAGATGTATGCTTC
CCCACCGAAACGATATCCGAATTGGGAGACGAGGGAGCGAGACAAATTCCTGATGAAGCCGGCGAACGTCGACGG
CGTAGACACCGGCGATGGCCCGATCTCTCCGCCCTGGAAGAATGGAGCCGTGAGGAAAAAGAGGAGCGCAATGGA
GACAATCGAGTCAAAAGGATCAGTGAGCCTATGCTCATCGCAGGCCGATTGCGCCCTCAGTATACAGGATGGCGA
CGTGAAGAGGATGAGGCGCCTTATCGGTTCACATATTTCAACGAGGAATTTCCGAGCACCATTCATGCTCAAACC
ATCTCTGAGCTGGTACAGCCAGGTGGTAGCTTCCGCGATTTGTTTATTCCAGATCCTCCCGAATTGGAAGATTCG
TCTGAAGACGAGGACTCGGAAGAGGAATCTTTTATGGAGCATGCAGCTCTCAATCACTCAACCAATCCCGCCAAC
AAGCCAATATATCACACAGACAATCAAAGTCAAGGCCAAGGCCATCAAACGAGCGTTAATCCTTGTATGACACCT
CAGACCGTTGTTCCCAACGGAAGAACTGCAAATGACCCTATGACTGGCAATGCTCCTCCGGTCAGAGGACCCTCG
CGTTTATCTGTCATCAGCGAAGGACACCCAGACTCCCACCGTGAGCTCTCGCCCGCACCTTCCAACACCCCTTTT
AGCAAAACCCCCAATCCGAAACCTAAACGCTACGGTCCACGGCCGACTTTCTGGCTAGATGTCCTCTCCCCGACA
GATGCAGAGATGCGTACGATTGCCAAAGCTTTTGGGATTCACGCATTGACGACAGAGGACATTATGATGCAAGAA
GCTCGAGAGAAAGTCGAGTTATTTCGCAGCTACTATTTCGTCAACTACCGTACTTTTGAGCAGGATACCAACAGC
GAGGACTATCTCGAGCCAGTGAACATGTATGTGGTGGTTTTCCGCGAAGGCGTGATCTCCTTCCATTTTTCGCAA
ACACCTCACCCAGCCAATGTTCGGCGGCGTATCCGCCAACTGATGGATTACCTGATCCTCAGCTCAGACTGGATT
TCATACGCACTGATTGATGACATTACCGATGTCTTCGGTCCGCTGATTCAAGCGATTGAAAATGAGGTCGATGAG
ATCGACGAGATGATCATGAAAATGCACTCTGCCAGCAAGGAGGTGTCGTCCAATGACAGTGTGCTTCCTTCATTC
GCACCAGGAGATATGCTGCGGCGAGTGGGAGAATGCCGCAAGAAGGTCATGGGACTGTACCGACTTCTCAGCAAC
AAGGCCGATGTAGTCAAGGGCTTTTCCAAGCGTTGCAATGAGCAGTGGGAGGTTGCCCCCAAGTCGGAGATTGGC
CTGTACCTCGGTGACATTCAGGATCACATCATGACGATGACTGGTAACCTAACGCACTACGAAACAATCCTTTCC
CGTGCACACTCCAATTATTTGGCGCAGATCAACATCCTCATGAACGAGCGTCAGGAACATACTGCCGATGTCCTG
GGTAAGCTGACTGTTCTTGGTACGATTGTCCTACCGATGAACATCATCTGCGGCATGTGGGGGATGAACGTGAAG
GTACCAGGTCAGGAAATCGATAGCCTTACATGGTTCTGGTGCATTACCGCCGGACTATGCGTATTTGCATTTGTA
TCTGTTTGGACTGCTAAAAGAGTCTACAAAATTGTATAG
Gene >Pro_DTO377G3_2|g4162.t1
ATGGCTCCGCCCATGATCCCAACACCTGGCATAGCGGCCTCCCGACCGCCTCGTTCCTCGCATTCGTCTAGCCGT
CCACAGCACAGCGATTATCCACCCGACGCTGATAACAACGCTAGCTATGGCCCAATGGGCGGCGGTCGGGCTCCA
GGGACTAGTAGTCCGGTACCCGTCTCGGAGACCACGCCAGCCAACAATACCCGCTTCATCCCCCCCGCTGATTAT
GCTGCTGGCAAACCCTCCAAGTCCTCCAAGCGCAAAAAGAACCGCAATCGCAAACGTCGCAATCGACACCAGTCT
TTTATTCCACCTAGCCGGGAGGAATCTCATGATATTCCTGGGGAGACTTCGGATGCTGGAGGTGTTAGAGATTCA
ATGGAGGCCGACCGGCCAACCTCGAGGGACAAGTCGTTCTTCAAATTGGGACGCAATCTGAGTAACACAAGCTTG
GAGAGCGATGCGTTGTTAGACCATCGGTAAAATCTCGTGATATTGAGCGATCTCGGAGCTTGAGATAGATACTAA
TTTTTCTTTCCGAACAGGGACCAACCTTTGATGCGACCTCGTCGTGACAGTCGCGTTGCATCGTCATTCCGGCCG
AGCTCCCTAACATCCAATGTCTTCCGATCGAACGATGGGCAATCTCGCAGCACCCCGAGGGGAGGACGGGGCCAA
CAACATCACAATGGTGATAGTGACGAAGAGGATGCCAATGATCGGACCCCATTGATGCGGCCAGTTTCCAGTCAC
ACGCCCGGCAATAATTGGTATGGAACGGACAATCGCCCGAATTTGTTCTCCTCACGTGCTCGACAGTACTCTACT
CGGACTATGTCCTCCGGCTGTTCACCAAAGGATGATCGCAGCCCACTCTATTCTCCCACTGTGGAGCGAGACTAC
GATGTCAACAACCCGCCGTCCATTCCCGGGTCCCCAAAGCTGGGCCCGGAGATGAATTATGACGATGCCGTGGTA
ACAGGAGCTGATTGGGACTTCTCGTTAGCTCGGACAATGGAGAATCACCGGGAGTCTATGAACGCCTTGAACGAC
ACGCTGATCGACATAGACGGGAATGGATTGCACTCACATTCTGCGCCATCTTCTTCGCCTGGGTCGCCGCTTCTC
TCTCCTCACCAAGAATTACGGCGGCGCCGGACCGTGACATTACCAGCACAGGAAGATGTATGCTTCCCCACCGAA
ACGATATCCGAATTGGGAGACGAGGGAGCGAGACAAATTCCTGATGAAGCCGGCGAACGTCGACGGCGTAGACAC
CGGCGATGGCCCGATCTCTCCGCCCTGGAAGAATGGAGCCGTGAGGAAAAAGAGGAGCGCAATGGAGACAATCGA
GTCAAAAGGATCAGTGAGCCTATGCTCATCGCAGGCCGATTGCGCCCTCAGTATACAGGATGGCGACGTGAAGAG
GATGAGGCGCCTTATCGGTTCACATATTTCAACGAGGAATTTCCGAGCACCATTCATGCTCAAACCATCTCTGAG
CTGGTACAGCCAGGTGGTAGCTTCCGCGATTTGTTTATTCCAGATCCTCCCGAATTGGAAGATTCGTCTGAAGAC
GAGGACTCGGAAGAGGAATCTTTTATGGAGCATGCAGCTCTCAATCACTCAACCAATCCCGCCAACAAGCCAATA
TATCACACAGACAATCAAAGTCAAGGCCAAGGCCATCAAACGAGCGTTAATCCTTGTATGACACCTCAGACCGTT
GTTCCCAACGGAAGAACTGCAAATGACCCTATGACTGGCAATGCTCCTCCGGTCAGAGGACCCTCGCGTTTATCT
GTCATCAGCGAAGGACACCCAGACTCCCACCGTGAGCTCTCGCCCGCACCTTCCAACACCCCTTTTAGCAAAACC
CCCAATCCGAAACCTAAACGCTACGGTCCACGGCCGACTTTCTGGCTAGATGTCCTCTCCCCGACAGATGCAGAG
ATGCGTACGATTGCCAAAGCTTTTGGGATTCACGCATTGACGACAGAGGACATTATGATGCAAGAAGCTCGAGAG
AAAGTCGAGTTATTTCGCAGCTACTATTTCGTCAACTACCGTACTTTTGAGCAGGATACCAACAGCGAGGACTAT
CTCGAGCCAGTGAACATGTATGTGGTGGTTTTCCGCGAAGGCGTGATCTCCTTCCATTTTTCGCAAACACCTCAC
CCAGCCAATGTTCGGCGGCGTATCCGCCAACTGATGGATTACCTGATCCTCAGCTCAGACTGGATTTCATACGCA
CTGATTGATGACATTACCGATGTCTTCGGTCCGCTGATTCAAGCGATTGAAAATGAGGTCGATGAGATCGACGAG
ATGATCATGAAAATGCACTCTGCCAGCAAGGAGGTGTCGTCCAATGACAGTGTGCTTCCTTCATTCGCACCAGGA
GATATGCTGCGGCGAGTGGGAGAATGCCGCAAGAAGGTCATGGGACTGTACCGACTTCTCAGCAACAAGGCCGAT
GTAGTCAAGGGCTTTTCCAAGCGTTGCAATGAGCAGTGGGAGGTTGCCCCCAAGTCGGAGATTGGCCTGTACCTC
GGTGACATTCAGGATCACATCATGACGATGACTGGTAACCTAACGCACTACGAAACGTAAGTTTCTTACCTATAT
TTAAGGCTGGTCTATCCAAACGTTGAAGTCGCTGACTGTGTCGTCCAGAATCCTTTCCCGTGCACACTCCAATTA
TTTGGCGCAGATCAACATCCTCATGAACGAGCGTCAGGAACATACTGCCGATGTCCTGGGTAAGCTGACTGTTCT
TGGTACGATTGTCCTACCGATGAACATCATCTGCGGCATGTGGGGGATGAACGTGAAGGTACCAGGTCAGGAAAT
CGATAGCCTTACATGGTTCTGGTGCAGTATGTATTTCCTTTTCTTTGCCAGATGATTTGCTAATACTTCATAGTT
ACCGCCGGACTATGCGTATTTGCATTTGTATCTGTTTGGACTGCTAAAAGAGTCTACAAAATTGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail