Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4154.t1
Gene name
Locationscaffold_08:172896..174304
Strand+
Gene length (bp)1408
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01280 Ribosomal_L19e Ribosomal protein L19e 5.2E-60 98 241

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0008152 metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:0005198 structural molecule activity No
GO:0043228 non-membrane-bounded organelle No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0019538 protein metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009058 biosynthetic process No
GO:0043229 intracellular organelle No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1034.95 581.00 1488.90
5d_25C Five days - 25 degrees Celsius 1088.05 608.88 1567.22
7d_25C Seven days - 25 degrees Celsius 1220.70 671.14 1770.25
10d_25C Ten days - 25 degrees Celsius 1575.88 851.43 2300.33
7d_15C Seven days - 15 degrees Celsius 1313.92 722.55 1905.29
7d_30C Seven days - 30 degrees Celsius 1133.04 633.59 1632.49

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.889027 no
3d_25C 7d_25C 0.593344 no
3d_25C 7d_15C 0.396294 no
3d_25C 7d_30C 0.787640 no
3d_25C 10d_25C 0.089205 no
5d_25C 7d_25C 0.730213 no
5d_25C 7d_15C 0.522791 no
5d_25C 7d_30C 0.915082 no
5d_25C 10d_25C 0.145347 no
7d_25C 7d_15C 0.839797 no
7d_25C 7d_30C 0.834553 no
7d_25C 10d_25C 0.372447 no
7d_15C 7d_30C 0.637262 no
7d_15C 10d_25C 0.556173 no
7d_30C 10d_25C 0.210210 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4154.t1
MYAVQSGGLYYIADHSFLDRNIKSGDTTCLQYHVIFIFIRTFPNVSKLSFPGLQDLQAPSSQFGLALGALSNSHR
RDFSVPRTSSANDRRYADIKMVNLTTQKRLAASVVGCGKRKIWLDPNEMNEISNANSRQTIRKLVSDGLIIRKPV
TMHSRASARELNEARRNGRHRGLGKRKGTKDARMPSQVLWMRRMRVLRRLLVRYRAAGKIDKHLYHELYHLSKGN
TFKHKRALVEHIQKAKAERARDRVLKEEMDAKRAKNKALRERRLERKDAKRDALINEE*
Coding >Pro_DTO377G3_2|g4154.t1
ATGTACGCCGTACAGAGTGGTGGACTTTATTATATTGCAGATCACTCTTTCCTAGATAGGAATATCAAATCAGGT
GATACTACTTGTCTTCAGTATCACGTGATATTCATCTTCATTCGAACTTTTCCCAATGTAAGTAAGCTTAGCTTC
CCCGGACTGCAAGATCTTCAAGCTCCATCATCCCAATTCGGACTAGCGTTAGGTGCCCTCTCAAACTCTCACCGT
CGGGATTTCTCAGTGCCACGAACATCATCCGCCAACGACCGTCGATACGCCGACATCAAGATGGTCAACCTTACC
ACCCAGAAGCGCCTCGCCGCCTCCGTGGTCGGCTGCGGCAAGCGCAAGATTTGGCTCGACCCCAATGAGATGAAC
GAGATCTCCAACGCCAACTCTCGCCAGACCATCCGCAAGCTCGTCAGCGATGGCCTGATCATCCGCAAGCCCGTC
ACCATGCACTCCCGTGCCAGCGCCCGTGAACTCAACGAGGCCCGCCGAAATGGCCGTCACCGCGGTCTGGGTAAG
CGCAAGGGTACCAAGGATGCCCGTATGCCCAGCCAAGTCCTCTGGATGCGCCGCATGCGTGTTCTCCGTCGTCTG
CTCGTCCGCTACCGCGCCGCCGGCAAGATCGACAAGCACCTCTACCACGAGCTTTACCACCTGAGCAAGGGTAAC
ACCTTCAAGCACAAGCGTGCCCTCGTCGAGCACATCCAGAAGGCTAAGGCTGAGCGTGCACGCGACCGTGTCCTC
AAGGAGGAGATGGATGCTAAGCGTGCCAAGAACAAGGCTCTCCGTGAGCGCCGGTTGGAGCGCAAGGATGCCAAG
CGCGATGCTCTGATCAACGAGGAGTAA
Transcript >Pro_DTO377G3_2|g4154.t1
ATGTACGCCGTACAGAGTGGTGGACTTTATTATATTGCAGATCACTCTTTCCTAGATAGGAATATCAAATCAGGT
GATACTACTTGTCTTCAGTATCACGTGATATTCATCTTCATTCGAACTTTTCCCAATGTAAGTAAGCTTAGCTTC
CCCGGACTGCAAGATCTTCAAGCTCCATCATCCCAATTCGGACTAGCGTTAGGTGCCCTCTCAAACTCTCACCGT
CGGGATTTCTCAGTGCCACGAACATCATCCGCCAACGACCGTCGATACGCCGACATCAAGATGGTCAACCTTACC
ACCCAGAAGCGCCTCGCCGCCTCCGTGGTCGGCTGCGGCAAGCGCAAGATTTGGCTCGACCCCAATGAGATGAAC
GAGATCTCCAACGCCAACTCTCGCCAGACCATCCGCAAGCTCGTCAGCGATGGCCTGATCATCCGCAAGCCCGTC
ACCATGCACTCCCGTGCCAGCGCCCGTGAACTCAACGAGGCCCGCCGAAATGGCCGTCACCGCGGTCTGGGTAAG
CGCAAGGGTACCAAGGATGCCCGTATGCCCAGCCAAGTCCTCTGGATGCGCCGCATGCGTGTTCTCCGTCGTCTG
CTCGTCCGCTACCGCGCCGCCGGCAAGATCGACAAGCACCTCTACCACGAGCTTTACCACCTGAGCAAGGGTAAC
ACCTTCAAGCACAAGCGTGCCCTCGTCGAGCACATCCAGAAGGCTAAGGCTGAGCGTGCACGCGACCGTGTCCTC
AAGGAGGAGATGGATGCTAAGCGTGCCAAGAACAAGGCTCTCCGTGAGCGCCGGTTGGAGCGCAAGGATGCCAAG
CGCGATGCTCTGATCAACGAGGAGTAA
Gene >Pro_DTO377G3_2|g4154.t1
ATGTACGCCGTACAGAGTGGTGGACTTTATTATATTGCAGATCACTCTTTCCTAGATAGGAATATCAAATCAGGT
GATACTACTTGTCTTCAGTATCACGTGATATTGTTCGTTTTTTGGCCGTCTACAACGAAAGCCACGGCAAAGAGC
GAAAGAGAAAAAAAGAAGAGAACCCCAAATTGTAATCTTGTTATTATCCCAGCATCTTCATTCGAACTTTTCCCA
ATGTAAGTAAGCTTAGCTTCCCCGGACTGCAAGATCTTCAAGCTCCATCATCCCAATTCGGACTAGCGTTAGGGT
ATGCACCCTGGAGCACTCCGCCCATTGTGGAAGGAGCACTCGCTTAGCCCTCGGCTGACCTAATCTGGCCCGCAG
TGCCCTCTCAAACTCTCACCGTCGGGATTTCTCAGTGCCACGAACATCATCCGCCAACGACCGTCGATACGCCGA
CATCAAGATGTGAGTTCCATCTCCAAGCTGTTCTTGAACTTCTCGAATGCACTCCCGTGTGCTGTGGAGATTCAT
GTCCCAACACCCAACTCGTGCACCCGAAATTTTCGTTATAGTGGAGGAACAACTTCGTGATGTGTGTGCTATGAT
GCTGACCGGGTCTTTCACCACCACAGGGTCAACCTTACCACCCAGAAGCGCCTCGCCGCCTCCGTGGTCGGCTGC
GGCAAGCGCAAGATTTGGCTCGACCCCAATGAGATGAACGAGATCTCCAACGCCAACTCTCGCCAGACCATCCGC
AAGCTCGTCAGCGATGGCCTGATCATCCGCAAGCCCGTCACCATGCACTCCCGTGCCAGCGCCCGTGAACTCAAC
GAGGCCCGCCGAAATGGCCGTCACCGCGGTCTGGGTAAGCGCAAGGGTACCAAGGATGCCCGTATGCCCAGGTAT
GCACACCACCACTACCACCACCGTCTTTGTCTCCTACATCGGACTCGCCCGACGGCTAGAACCAGGACACAGTTG
CTGATGTCGATTTTCTCTGTTTAGCCAAGTCCTCTGGATGCGCCGCATGCGTGTTCTCCGTCGTCTGCTCGTCCG
CTACCGCGCCGCCGGCAAGATCGACAAGCACCTCTACCACGAGCTTTACCACCTGAGCAAGGGTAACACCTTCAA
GCACAAGCGTGCCCTCGTCGAGCACGTAAGTTACAACCCGAATCAACCCCACGGATGACGATCGAATATGAACAT
GAACCCCTTGAATTACGCAAAGGAACGGATCCAGGCTGACTCGTTCTCTTTTTCACCGCTACAGATCCAGAAGGC
TAAGGCTGAGCGTGCACGCGACCGTGTCCTCAAGGAGGAGATGGATGCTAAGCGTGCCAAGAACAAGGCTCTCCG
TGAGCGCCGGTTGGAGCGCAAGGATGCCAAGCGCGATGCTCTGATCAACGAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail