Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4145.t1
Gene name
Locationscaffold_08:133842..134525
Strand-
Gene length (bp)683
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 39.31 16.53 62.08
5d_25C Five days - 25 degrees Celsius 29.76 10.11 49.41
7d_25C Seven days - 25 degrees Celsius 26.91 8.88 44.94
10d_25C Ten days - 25 degrees Celsius 16.73 4.29 29.17
7d_15C Seven days - 15 degrees Celsius 8.50 0.39 16.60
7d_30C Seven days - 30 degrees Celsius 37.67 14.32 61.01

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.485336 no
3d_25C 7d_25C 0.323910 no
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.933836 no
3d_25C 10d_25C 0.014377 yes
5d_25C 7d_25C 0.849779 no
5d_25C 7d_15C 0.010411 yes
5d_25C 7d_30C 0.576776 no
5d_25C 10d_25C 0.132302 no
7d_25C 7d_15C 0.016361 yes
7d_25C 7d_30C 0.407768 no
7d_25C 10d_25C 0.249750 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.164015 no
7d_30C 10d_25C 0.023429 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4145.t1
MRFSIAALALGATGAMAGVVTETLTEYTTYCPEATSIVHGSHTYSISTPGYITMSHGPYTVTRPISTSTVTECNS
CSSTAVVSTPVASAPVASAPAPSAPVVSTPLASSPVASSSTPLIPVVPSVVTSTPLVPTAGSTGVPSVPSSPSSA
PSSPSSAVTPSQPAFNTGAMNAATGAGAGLAAILGAVALLL*
Coding >Pro_DTO377G3_2|g4145.t1
ATGCGTTTCTCTATTGCCGCTCTCGCTCTCGGTGCTACTGGTGCCATGGCCGGTGTTGTCACCGAGACCCTCACC
GAGTACACCACCTACTGCCCTGAGGCTACCTCTATTGTACACGGAAGCCACACCTACAGCATTTCCACCCCCGGC
TACATCACCATGAGCCACGGTCCCTACACTGTCACCCGTCCCATCTCGACCTCCACCGTGACTGAGTGCAACTCC
TGCTCTTCCACCGCCGTGGTCTCTACTCCCGTGGCCTCTGCTCCTGTGGCATCTGCTCCCGCGCCCTCTGCTCCC
GTGGTCTCTACTCCCTTGGCCTCCAGCCCCGTGGCCAGCAGCAGCACTCCCCTCATCCCCGTCGTCCCCAGCGTC
GTCACCTCCACCCCTCTGGTCCCCACCGCCGGCTCCACTGGCGTGCCCAGCGTTCCCTCCAGCCCCTCCAGTGCT
CCCTCCAGCCCCTCCAGCGCTGTTACCCCCTCCCAGCCCGCCTTCAACACCGGTGCCATGAACGCCGCTACCGGT
GCTGGTGCCGGTTTGGCTGCCATCCTTGGTGCCGTTGCTCTCCTGCTGTAA
Transcript >Pro_DTO377G3_2|g4145.t1
ATGCGTTTCTCTATTGCCGCTCTCGCTCTCGGTGCTACTGGTGCCATGGCCGGTGTTGTCACCGAGACCCTCACC
GAGTACACCACCTACTGCCCTGAGGCTACCTCTATTGTACACGGAAGCCACACCTACAGCATTTCCACCCCCGGC
TACATCACCATGAGCCACGGTCCCTACACTGTCACCCGTCCCATCTCGACCTCCACCGTGACTGAGTGCAACTCC
TGCTCTTCCACCGCCGTGGTCTCTACTCCCGTGGCCTCTGCTCCTGTGGCATCTGCTCCCGCGCCCTCTGCTCCC
GTGGTCTCTACTCCCTTGGCCTCCAGCCCCGTGGCCAGCAGCAGCACTCCCCTCATCCCCGTCGTCCCCAGCGTC
GTCACCTCCACCCCTCTGGTCCCCACCGCCGGCTCCACTGGCGTGCCCAGCGTTCCCTCCAGCCCCTCCAGTGCT
CCCTCCAGCCCCTCCAGCGCTGTTACCCCCTCCCAGCCCGCCTTCAACACCGGTGCCATGAACGCCGCTACCGGT
GCTGGTGCCGGTTTGGCTGCCATCCTTGGTGCCGTTGCTCTCCTGCTGTAA
Gene >Pro_DTO377G3_2|g4145.t1
ATGCGTTTCTCTATTGCCGCTCTCGCTCTCGGTGCTACTGGTGCCATGGCCGGTGTTGTCACCGAGACCCTCACC
GAGTACACCACCTACTGCCCTGAGGCTACCTCTATTGTACACGGAAGCCACACCTACAGCATTTCCACCGTATGT
TTTCCTGAGCAACAAGTCTTCGCCGCATACTAACAGCATTCCAGCCCGGCTACATCACCATGAGCCACGGTCCCT
ACACTGTCACCCGTCCCATCTCGACCTCCACCGTGACTGAGTGCAACTCCTGGTAAGGATTTCTCTATATCCAAC
GTGACCAATTAATTTAATCTAACACATTACTTAGCTCTTCCACCGCCGTGGTCTCTACTCCCGTGGCCTCTGCTC
CTGTGGCATCTGCTCCCGCGCCCTCTGCTCCCGTGGTCTCTACTCCCTTGGCCTCCAGCCCCGTGGCCAGCAGCA
GCACTCCCCTCATCCCCGTCGTCCCCAGCGTCGTCACCTCCACCCCTCTGGTCCCCACCGCCGGCTCCACTGGCG
TGCCCAGCGTTCCCTCCAGCCCCTCCAGTGCTCCCTCCAGCCCCTCCAGCGCTGTTACCCCCTCCCAGCCCGCCT
TCAACACCGGTGCCATGAACGCCGCTACCGGTGCTGGTGCCGGTTTGGCTGCCATCCTTGGTGCCGTTGCTCTCC
TGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail