Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4137.t1
Gene name
Locationscaffold_08:110911..111703
Strand+
Gene length (bp)792
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 6.3E-08 58 220

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 33.15 15.75 50.55
5d_25C Five days - 25 degrees Celsius 44.05 22.41 65.69
7d_25C Seven days - 25 degrees Celsius 49.36 25.86 72.87
10d_25C Ten days - 25 degrees Celsius 61.16 33.67 88.65
7d_15C Seven days - 15 degrees Celsius 33.52 15.74 51.31
7d_30C Seven days - 30 degrees Celsius 44.43 21.74 67.12

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.348389 no
3d_25C 7d_25C 0.148853 no
3d_25C 7d_15C 0.982001 no
3d_25C 7d_30C 0.347695 no
3d_25C 10d_25C 0.016361 yes
5d_25C 7d_25C 0.752440 no
5d_25C 7d_15C 0.385846 no
5d_25C 7d_30C 0.985822 no
5d_25C 10d_25C 0.238197 no
7d_25C 7d_15C 0.161285 no
7d_25C 7d_30C 0.775662 no
7d_25C 10d_25C 0.469464 no
7d_15C 7d_30C 0.375351 no
7d_15C 10d_25C 0.019090 yes
7d_30C 10d_25C 0.262996 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4137.t1
MSTDNPPQMLFFDMFGTVVSWRTCVTEELSVAAVHIVNYPSKDLPADLRDRAAAMTSDDWLAFVAEWRQTYNVFT
STFDTSEKFMSVDQHHYNALQVLLRQRGLEGLFTDEKLWELSFAWHRLNPWPDSVKGLELLNRRFATSTLSNGNV
SLLQDLQRHGSLPFTQLVSAENFGAYKPSPLVYKGAARKFGLEPGQCGMVAAHLRDLKAAKSCGFQTIYVERELE
EEMSQEQAANAKTGGYVDMWIDLESDGFREVARRFGVE*
Coding >Pro_DTO377G3_2|g4137.t1
ATGTCGACAGACAACCCGCCCCAGATGTTATTTTTCGATATGTTTGGCACAGTAGTTTCGTGGCGTACATGCGTC
ACGGAAGAGCTGAGTGTGGCTGCCGTACATATTGTTAATTATCCCAGCAAGGACCTCCCAGCCGACTTGCGGGAC
CGTGCTGCGGCCATGACCAGTGACGACTGGCTGGCTTTTGTCGCAGAATGGCGGCAGACTTACAATGTGTTCACT
AGTACATTTGACACATCCGAAAAGTTTATGTCCGTCGACCAGCACCACTACAATGCGCTTCAGGTCCTCTTGCGG
CAGCGCGGTCTGGAGGGCCTGTTCACTGACGAGAAGCTGTGGGAACTCTCTTTCGCGTGGCACCGGCTCAACCCT
TGGCCGGATAGTGTGAAAGGTCTTGAGTTGTTGAACCGGCGCTTTGCCACTTCTACCCTGTCGAATGGGAATGTC
TCTTTACTGCAGGACCTCCAACGTCATGGATCACTGCCTTTCACGCAACTTGTTAGTGCGGAGAACTTTGGGGCT
TACAAGCCTTCTCCATTGGTTTATAAGGGTGCTGCCAGGAAGTTTGGACTGGAGCCAGGCCAGTGCGGAATGGTT
GCAGCGCATCTGCGCGATTTGAAGGCTGCCAAGAGCTGTGGGTTTCAGACTATCTATGTTGAGCGTGAGCTAGAG
GAAGAGATGTCACAGGAGCAGGCTGCGAACGCCAAGACTGGCGGGTACGTGGATATGTGGATTGATCTTGAGTCT
GATGGCTTCCGAGAGGTGGCTAGGCGATTTGGGGTTGAGTAA
Transcript >Pro_DTO377G3_2|g4137.t1
ATGTCGACAGACAACCCGCCCCAGATGTTATTTTTCGATATGTTTGGCACAGTAGTTTCGTGGCGTACATGCGTC
ACGGAAGAGCTGAGTGTGGCTGCCGTACATATTGTTAATTATCCCAGCAAGGACCTCCCAGCCGACTTGCGGGAC
CGTGCTGCGGCCATGACCAGTGACGACTGGCTGGCTTTTGTCGCAGAATGGCGGCAGACTTACAATGTGTTCACT
AGTACATTTGACACATCCGAAAAGTTTATGTCCGTCGACCAGCACCACTACAATGCGCTTCAGGTCCTCTTGCGG
CAGCGCGGTCTGGAGGGCCTGTTCACTGACGAGAAGCTGTGGGAACTCTCTTTCGCGTGGCACCGGCTCAACCCT
TGGCCGGATAGTGTGAAAGGTCTTGAGTTGTTGAACCGGCGCTTTGCCACTTCTACCCTGTCGAATGGGAATGTC
TCTTTACTGCAGGACCTCCAACGTCATGGATCACTGCCTTTCACGCAACTTGTTAGTGCGGAGAACTTTGGGGCT
TACAAGCCTTCTCCATTGGTTTATAAGGGTGCTGCCAGGAAGTTTGGACTGGAGCCAGGCCAGTGCGGAATGGTT
GCAGCGCATCTGCGCGATTTGAAGGCTGCCAAGAGCTGTGGGTTTCAGACTATCTATGTTGAGCGTGAGCTAGAG
GAAGAGATGTCACAGGAGCAGGCTGCGAACGCCAAGACTGGCGGGTACGTGGATATGTGGATTGATCTTGAGTCT
GATGGCTTCCGAGAGGTGGCTAGGCGATTTGGGGTTGAGTAA
Gene >Pro_DTO377G3_2|g4137.t1
ATGTCGACAGACAACCCGCCCCAGATGTTATTTTTCGATATGTTTGGCACAGTAGTTTCGTGGCGTACATGCGTC
ACGGAAGAGCTGAGTGTGGCTGCCGTACATATTGTTAATTATCCCAGCAAGGACCTCCCAGCCGACTTGCGGGAC
CGTGCTGCGGCCATGACCAGTGACGACTGGCTGGCTTTTGTCGCAGAATGGCGGCAGACTTACAATGTGTTCACT
AGTACATTTGACACATCCGAAAAGTTTATGTCCGTCGACCAGCACCACTACAATGCGCTTCAGGTCCTCTTGCGG
CAGCGCGGTCTGGAGGGCCTGTTCACTGACGAGAAGCTGTGGGAACTCTCTTTCGCGTGGCACCGGCTCAACCCT
TGGCCGGATAGTGTGAAAGGTCTTGAGTTGTTGAACCGGCGCTTTGCCACTTCTACCCTGTCGAATGGGAATGTC
TCTTTACTGCAGGACCTCCAACGTCATGGATCACTGCCTTTCACGCAACTTGTTAGTGCGGAGAACTTTGGGGCT
TACAAGCCTTCTCCATTGGTTTATAAGGGTGCTGCCAGGAAGTTTGGACTGGAGCCAGGCCAGTGCGGAATGGTT
GCAGCGCATCTGCGCGATTTGAAGGCTGCCAAGAGCTGTGGGTTTCAGACTATCTATGTTGAGCGTGAGCTAGAG
GAAGAGATGTCACAGGAGCAGGCTGCGAACGCCAAGACTGGCGGGTACGTGGATATGTGGATTGATCTTGAGTCT
GATGGCTTCCGAGAGGTGGCTAGGCGATTTGGGGTTGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail