Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g4136.t1
Gene name
Locationscaffold_08:104322..109760
Strand-
Gene length (bp)5438
Transcript length (bp)4203
Coding sequence length (bp)4203
Protein length (aa) 1401

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12814 Mcp5_PH Meiotic cell cortex C-terminal pleckstrin homology 6.5E-45 1024 1170

GO

GO Term Description Terminal node
GO:0005543 phospholipid binding Yes
GO:0005515 protein binding Yes
GO:0005938 cell cortex Yes
GO:0032065 cortical protein anchoring Yes
GO:0032507 maintenance of protein location in cell No
GO:0044464 cell part No
GO:0051179 localization No
GO:0065007 biological regulation No
GO:0045185 maintenance of protein location No
GO:0065008 regulation of biological quality No
GO:0008289 lipid binding No
GO:0044444 cytoplasmic part No
GO:0099568 cytoplasmic region No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0009987 cellular process No
GO:0005737 cytoplasm No
GO:0005575 cellular_component No
GO:0051651 maintenance of location in cell No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0051235 maintenance of location No
GO:0044424 intracellular part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g4136.t1
MQRATAKTVRPVCHWSTPVKSPSVEFPLHPAFDQSIAPSENLSLERDKRRLQNMREVLWLAQGAEPRWFEAVHPA
HSQREMADLQWPPSMAHPSPAPSFRSRSRAPSKGGSRSRSRPSLRRRDSSPTPSSPPGLPTPAFSPDGQTDEDDI
DITEDTLSPFDPRRITPTLHASLVSEILSLRREIENKTKAIDGLEESLDESRTENETLTTNLSQATWEGRSLKHQ
IQLLEGGTSSAMAELARERDEAVENIGDVRKRLEQAQKKARSREEDVERTQLLWSRDQDSWADERRALERKIHVV
EGRLKTVLNEVAAAQEVVTIRSRSQPSENSDHIHDKNKESDSASVASSSLGRRRTSVTTLSSEEGEEAVIFHNVR
YSVMSIAPGSKNGSGLNLAEELDFEEEDEDEFVPSDDELPSSPEALPEERPMSVHSQGSHSVSFKARKILGLSLQ
SSDLYSPTALEFRARELGLASPVKLDPAVEYRDIGIQYSPPPSPTLEGKVVYDIVPEPMETVSEPEKEDDQKTKI
PRTNDSATLPVAPQMVSNSCQTVDELPSPPWTPNVADSPQPVESTPEPVQMKSASTQTDVVPEPCVAQSENLSPN
ASSKMDIPMIAIHPPGSEPSSPRNSVVLPPQTKNIACQANFRAIADCRSVAIQTEEIRFDQRPVRLPASLLPSAI
QDALPLPEPEEPSLEFCTVPPVPPRSEKRKQRRLITDQPTDHPVKPPRAPGPDHVQAYPGNNDNGPLSDDTLSNI
RRPLRSSSLFAGFENNSDDEGPHGERDVFTDDELLNRPFAAYTVSRGKLITSKSRPSLDGMPLPEIDEQLSSPES
RPPNIGRSRASQRSGMTSIRQPGMRKLAMISSGTAAHQKPRARSPSEPSLESGSTGSSIAPPFPVPIRLSSRNLP
LNGSDGPPSPTRSAARQFSDRGRQSVVRRPTLRRVRSAAATSQSDITERPETLSSPSRSTATFSPESPAYRPYRP
PPMPCDEITAPRERYGPSKRISHRTTPSQTWNHEQCDRKDSTGGVQPTSVVDAIAQTMVGEWMFKYVRRRKSFGM
GESKETWEGKNPDDVSANITNSGVRHKRWVWLAPYEGSIMWSSKQPTSGPALLGKSGRKFTIQSVLDVKDDNPIP
KGAGSSIPFNRSILVLTPQRALKFTALTIERHYVWLTALSFLSHSAIGLQELAALPPVPQEESPTPPQASLRRNP
IRDSIRVAKGRPRPVPKDKRSFNSAGAPAPVPEIPGGSIDLAADAPHVPRFSTHSRKRSNTAPRPPALHALRSFS
SAGTMPSSHSGTTAGSSELHFPAMQPPAPPPGIGSRRSSISRRTSEASGRASSGAGSNMFDIGTVRMEAFIDRHA
EQINRPRAPPRQRHVRKTSSQWSERRYEFDTPSVHGSEFSYRPDDPWRGF*
Coding >Pro_DTO377G3_2|g4136.t1
ATGCAACGTGCGACAGCTAAAACGGTCAGACCTGTTTGTCACTGGAGTACTCCTGTCAAAAGTCCCAGCGTTGAA
TTTCCCCTCCATCCCGCGTTCGACCAGTCGATTGCACCGAGCGAAAACCTGTCTCTGGAGAGAGACAAGCGCCGG
CTTCAAAACATGCGTGAAGTGCTCTGGTTAGCCCAAGGAGCAGAGCCTCGATGGTTTGAGGCGGTTCATCCGGCA
CATTCACAAAGAGAGATGGCCGATTTACAGTGGCCGCCTTCCATGGCCCACCCCTCCCCGGCGCCATCCTTTAGA
TCCAGATCTCGAGCTCCATCCAAAGGAGGATCGAGATCGAGATCGAGACCGTCCTTGCGCCGGCGAGATTCCTCC
CCGACACCTTCCTCCCCACCTGGCCTCCCAACCCCCGCATTCTCCCCCGACGGACAAACAGACGAAGATGATATC
GATATCACCGAGGATACCCTATCCCCCTTCGACCCGCGGAGGATCACACCCACTCTCCATGCATCTCTCGTATCG
GAGATTCTCTCGCTACGGCGGGAGATAGAGAACAAAACCAAGGCAATCGATGGGTTAGAAGAGAGCTTGGACGAA
TCAAGGACTGAAAATGAAACACTGACCACGAATCTGTCCCAGGCGACCTGGGAAGGGCGCTCGTTGAAACATCAA
ATCCAACTATTGGAAGGTGGAACGTCATCTGCGATGGCCGAGCTAGCTCGGGAGCGCGATGAAGCGGTCGAGAAC
ATCGGCGATGTTCGTAAAAGGCTCGAGCAGGCACAGAAAAAAGCCCGAAGTCGGGAGGAGGACGTCGAACGAACT
CAATTACTCTGGAGTCGCGACCAAGACTCCTGGGCGGATGAACGCCGAGCCCTGGAACGCAAGATTCACGTAGTA
GAGGGCCGCTTGAAGACCGTTTTGAACGAGGTCGCAGCCGCCCAGGAAGTGGTGACTATCCGCTCGCGTTCACAA
CCGAGTGAGAATAGTGACCATATTCATGACAAGAATAAAGAAAGCGACTCAGCCAGTGTGGCATCTAGTAGCCTA
GGCCGCCGACGCACGAGCGTGACCACCTTGAGCTCAGAAGAAGGTGAAGAGGCGGTCATATTCCATAACGTGCGG
TACTCAGTTATGAGTATCGCGCCTGGAAGCAAGAATGGTTCAGGTTTGAACCTGGCGGAGGAACTCGACTTCGAG
GAAGAGGATGAGGATGAGTTTGTCCCATCTGATGATGAGCTGCCTTCCTCTCCGGAGGCGCTGCCCGAAGAACGC
CCAATGTCGGTTCACTCACAGGGGTCGCATAGTGTTTCTTTCAAGGCCAGGAAGATCCTAGGTCTTTCCCTGCAG
AGCTCGGACTTATACTCACCCACTGCCCTGGAGTTCCGTGCACGGGAACTCGGGCTTGCTAGCCCAGTGAAACTT
GACCCGGCAGTTGAATACCGCGATATCGGCATCCAGTACTCACCTCCTCCGTCGCCTACGCTAGAAGGGAAGGTT
GTATACGACATTGTTCCTGAGCCCATGGAAACCGTCTCAGAGCCCGAGAAAGAAGACGACCAGAAAACGAAAATA
CCTAGAACGAATGACAGCGCCACGCTCCCAGTTGCACCTCAGATGGTTTCTAATTCTTGTCAGACCGTGGATGAA
CTCCCAAGTCCTCCATGGACGCCGAATGTGGCTGACTCGCCTCAGCCTGTCGAGTCCACCCCGGAGCCGGTGCAA
ATGAAATCGGCATCCACCCAGACTGATGTCGTTCCGGAACCATGTGTTGCTCAAAGCGAAAACCTGTCCCCCAAT
GCCTCATCCAAGATGGACATTCCAATGATCGCTATCCACCCACCAGGCTCAGAGCCATCCTCACCTCGAAATAGT
GTCGTTCTTCCACCGCAGACCAAGAACATCGCTTGCCAGGCCAACTTCCGGGCAATTGCTGATTGCCGATCCGTC
GCCATCCAAACCGAGGAAATCCGTTTCGATCAACGCCCTGTCAGACTTCCTGCCAGTCTTCTTCCTTCTGCTATT
CAAGATGCACTACCTCTCCCTGAACCCGAAGAGCCTAGCCTCGAGTTTTGCACTGTGCCCCCGGTTCCGCCACGG
TCCGAGAAACGAAAGCAGAGACGTCTGATAACAGATCAGCCGACAGATCATCCCGTGAAGCCTCCTAGAGCACCT
GGTCCAGATCATGTGCAGGCGTACCCCGGTAACAACGATAATGGTCCGCTCTCAGATGATACCTTGTCCAATATT
CGACGGCCTCTACGTTCAAGCAGTCTCTTCGCCGGCTTTGAGAATAACAGCGATGACGAAGGCCCGCATGGCGAA
CGCGATGTCTTCACCGACGATGAGCTCCTTAACCGCCCTTTTGCCGCATACACTGTCAGTCGTGGCAAGCTCATC
ACTTCGAAATCAAGACCTAGCTTGGACGGCATGCCTCTCCCCGAGATCGACGAGCAGCTATCTTCCCCGGAGTCA
AGACCACCCAATATTGGCCGTTCTCGGGCTTCCCAGCGGTCTGGTATGACCAGTATTCGCCAGCCCGGCATGCGC
AAATTAGCCATGATTTCCAGCGGAACCGCCGCGCACCAGAAACCCCGTGCCCGCAGTCCCAGTGAACCAAGCCTC
GAGAGCGGCAGTACAGGCTCAAGCATCGCACCGCCATTCCCTGTACCCATCCGTCTCAGCTCACGCAACCTTCCG
CTGAACGGTAGCGACGGGCCTCCAAGTCCTACTCGCTCAGCCGCCAGACAGTTCTCGGACCGTGGTCGCCAATCT
GTCGTCCGGCGCCCAACTCTCCGCCGAGTGCGATCCGCAGCAGCAACGTCACAGTCGGATATTACCGAGAGACCA
GAAACACTTTCTTCCCCGTCACGATCGACCGCAACGTTTTCCCCAGAAAGCCCCGCATACCGACCATATCGGCCA
CCGCCAATGCCGTGTGATGAGATCACAGCACCTCGTGAGCGGTACGGGCCATCGAAACGCATCTCGCATCGCACG
ACTCCATCCCAAACCTGGAACCATGAACAGTGCGATAGAAAGGATTCCACCGGTGGTGTGCAGCCAACTAGCGTC
GTTGATGCTATTGCTCAGACTATGGTTGGCGAGTGGATGTTCAAATACGTCCGTCGACGCAAATCATTTGGGATG
GGCGAGTCCAAAGAGACTTGGGAGGGCAAGAACCCTGACGATGTGTCGGCGAATATTACGAACAGTGGTGTGCGA
CATAAACGATGGGTTTGGCTCGCCCCGTACGAAGGCTCCATTATGTGGAGTAGTAAACAGCCTACGAGTGGGCCT
GCATTACTCGGCAAAAGTGGCCGGAAGTTCACGATTCAATCCGTCTTGGACGTCAAAGACGACAACCCCATACCC
AAAGGCGCCGGCTCTTCGATCCCATTCAACCGCTCTATCCTGGTGCTGACACCACAGCGTGCTCTGAAATTCACA
GCACTAACCATCGAACGCCACTACGTTTGGCTAACAGCCCTATCCTTCCTCAGCCATTCCGCAATCGGCCTCCAA
GAATTAGCAGCTCTACCTCCAGTCCCACAAGAAGAATCGCCAACCCCACCTCAAGCCTCCCTCCGCCGAAACCCA
ATTCGCGACTCCATTCGGGTCGCAAAGGGCCGTCCCCGCCCAGTGCCAAAGGACAAACGCTCCTTCAACAGTGCC
GGTGCTCCGGCTCCAGTCCCCGAAATCCCAGGGGGCAGCATCGACCTAGCAGCCGACGCACCCCACGTTCCCCGT
TTCTCAACCCACAGCCGCAAACGCAGCAACACCGCGCCCCGTCCCCCAGCTCTCCACGCTCTCCGCAGCTTCTCC
AGCGCCGGTACTATGCCTTCTTCACACAGCGGCACCACGGCCGGCTCGTCGGAGCTACATTTCCCCGCCATGCAG
CCCCCAGCCCCACCTCCAGGCATTGGAAGTCGTCGTAGCAGTATCAGCCGACGCACTTCCGAGGCGAGTGGCCGT
GCTTCCAGTGGGGCTGGCAGCAACATGTTTGACATAGGCACTGTGCGTATGGAGGCTTTCATCGACCGCCACGCA
GAACAGATTAATCGTCCTCGTGCGCCTCCGCGCCAGCGCCATGTCCGCAAGACATCCAGTCAGTGGAGTGAGAGA
CGGTATGAGTTTGACACGCCTTCGGTCCATGGCAGCGAGTTCTCATACCGTCCTGATGATCCGTGGCGGGGTTTC
TAA
Transcript >Pro_DTO377G3_2|g4136.t1
ATGCAACGTGCGACAGCTAAAACGGTCAGACCTGTTTGTCACTGGAGTACTCCTGTCAAAAGTCCCAGCGTTGAA
TTTCCCCTCCATCCCGCGTTCGACCAGTCGATTGCACCGAGCGAAAACCTGTCTCTGGAGAGAGACAAGCGCCGG
CTTCAAAACATGCGTGAAGTGCTCTGGTTAGCCCAAGGAGCAGAGCCTCGATGGTTTGAGGCGGTTCATCCGGCA
CATTCACAAAGAGAGATGGCCGATTTACAGTGGCCGCCTTCCATGGCCCACCCCTCCCCGGCGCCATCCTTTAGA
TCCAGATCTCGAGCTCCATCCAAAGGAGGATCGAGATCGAGATCGAGACCGTCCTTGCGCCGGCGAGATTCCTCC
CCGACACCTTCCTCCCCACCTGGCCTCCCAACCCCCGCATTCTCCCCCGACGGACAAACAGACGAAGATGATATC
GATATCACCGAGGATACCCTATCCCCCTTCGACCCGCGGAGGATCACACCCACTCTCCATGCATCTCTCGTATCG
GAGATTCTCTCGCTACGGCGGGAGATAGAGAACAAAACCAAGGCAATCGATGGGTTAGAAGAGAGCTTGGACGAA
TCAAGGACTGAAAATGAAACACTGACCACGAATCTGTCCCAGGCGACCTGGGAAGGGCGCTCGTTGAAACATCAA
ATCCAACTATTGGAAGGTGGAACGTCATCTGCGATGGCCGAGCTAGCTCGGGAGCGCGATGAAGCGGTCGAGAAC
ATCGGCGATGTTCGTAAAAGGCTCGAGCAGGCACAGAAAAAAGCCCGAAGTCGGGAGGAGGACGTCGAACGAACT
CAATTACTCTGGAGTCGCGACCAAGACTCCTGGGCGGATGAACGCCGAGCCCTGGAACGCAAGATTCACGTAGTA
GAGGGCCGCTTGAAGACCGTTTTGAACGAGGTCGCAGCCGCCCAGGAAGTGGTGACTATCCGCTCGCGTTCACAA
CCGAGTGAGAATAGTGACCATATTCATGACAAGAATAAAGAAAGCGACTCAGCCAGTGTGGCATCTAGTAGCCTA
GGCCGCCGACGCACGAGCGTGACCACCTTGAGCTCAGAAGAAGGTGAAGAGGCGGTCATATTCCATAACGTGCGG
TACTCAGTTATGAGTATCGCGCCTGGAAGCAAGAATGGTTCAGGTTTGAACCTGGCGGAGGAACTCGACTTCGAG
GAAGAGGATGAGGATGAGTTTGTCCCATCTGATGATGAGCTGCCTTCCTCTCCGGAGGCGCTGCCCGAAGAACGC
CCAATGTCGGTTCACTCACAGGGGTCGCATAGTGTTTCTTTCAAGGCCAGGAAGATCCTAGGTCTTTCCCTGCAG
AGCTCGGACTTATACTCACCCACTGCCCTGGAGTTCCGTGCACGGGAACTCGGGCTTGCTAGCCCAGTGAAACTT
GACCCGGCAGTTGAATACCGCGATATCGGCATCCAGTACTCACCTCCTCCGTCGCCTACGCTAGAAGGGAAGGTT
GTATACGACATTGTTCCTGAGCCCATGGAAACCGTCTCAGAGCCCGAGAAAGAAGACGACCAGAAAACGAAAATA
CCTAGAACGAATGACAGCGCCACGCTCCCAGTTGCACCTCAGATGGTTTCTAATTCTTGTCAGACCGTGGATGAA
CTCCCAAGTCCTCCATGGACGCCGAATGTGGCTGACTCGCCTCAGCCTGTCGAGTCCACCCCGGAGCCGGTGCAA
ATGAAATCGGCATCCACCCAGACTGATGTCGTTCCGGAACCATGTGTTGCTCAAAGCGAAAACCTGTCCCCCAAT
GCCTCATCCAAGATGGACATTCCAATGATCGCTATCCACCCACCAGGCTCAGAGCCATCCTCACCTCGAAATAGT
GTCGTTCTTCCACCGCAGACCAAGAACATCGCTTGCCAGGCCAACTTCCGGGCAATTGCTGATTGCCGATCCGTC
GCCATCCAAACCGAGGAAATCCGTTTCGATCAACGCCCTGTCAGACTTCCTGCCAGTCTTCTTCCTTCTGCTATT
CAAGATGCACTACCTCTCCCTGAACCCGAAGAGCCTAGCCTCGAGTTTTGCACTGTGCCCCCGGTTCCGCCACGG
TCCGAGAAACGAAAGCAGAGACGTCTGATAACAGATCAGCCGACAGATCATCCCGTGAAGCCTCCTAGAGCACCT
GGTCCAGATCATGTGCAGGCGTACCCCGGTAACAACGATAATGGTCCGCTCTCAGATGATACCTTGTCCAATATT
CGACGGCCTCTACGTTCAAGCAGTCTCTTCGCCGGCTTTGAGAATAACAGCGATGACGAAGGCCCGCATGGCGAA
CGCGATGTCTTCACCGACGATGAGCTCCTTAACCGCCCTTTTGCCGCATACACTGTCAGTCGTGGCAAGCTCATC
ACTTCGAAATCAAGACCTAGCTTGGACGGCATGCCTCTCCCCGAGATCGACGAGCAGCTATCTTCCCCGGAGTCA
AGACCACCCAATATTGGCCGTTCTCGGGCTTCCCAGCGGTCTGGTATGACCAGTATTCGCCAGCCCGGCATGCGC
AAATTAGCCATGATTTCCAGCGGAACCGCCGCGCACCAGAAACCCCGTGCCCGCAGTCCCAGTGAACCAAGCCTC
GAGAGCGGCAGTACAGGCTCAAGCATCGCACCGCCATTCCCTGTACCCATCCGTCTCAGCTCACGCAACCTTCCG
CTGAACGGTAGCGACGGGCCTCCAAGTCCTACTCGCTCAGCCGCCAGACAGTTCTCGGACCGTGGTCGCCAATCT
GTCGTCCGGCGCCCAACTCTCCGCCGAGTGCGATCCGCAGCAGCAACGTCACAGTCGGATATTACCGAGAGACCA
GAAACACTTTCTTCCCCGTCACGATCGACCGCAACGTTTTCCCCAGAAAGCCCCGCATACCGACCATATCGGCCA
CCGCCAATGCCGTGTGATGAGATCACAGCACCTCGTGAGCGGTACGGGCCATCGAAACGCATCTCGCATCGCACG
ACTCCATCCCAAACCTGGAACCATGAACAGTGCGATAGAAAGGATTCCACCGGTGGTGTGCAGCCAACTAGCGTC
GTTGATGCTATTGCTCAGACTATGGTTGGCGAGTGGATGTTCAAATACGTCCGTCGACGCAAATCATTTGGGATG
GGCGAGTCCAAAGAGACTTGGGAGGGCAAGAACCCTGACGATGTGTCGGCGAATATTACGAACAGTGGTGTGCGA
CATAAACGATGGGTTTGGCTCGCCCCGTACGAAGGCTCCATTATGTGGAGTAGTAAACAGCCTACGAGTGGGCCT
GCATTACTCGGCAAAAGTGGCCGGAAGTTCACGATTCAATCCGTCTTGGACGTCAAAGACGACAACCCCATACCC
AAAGGCGCCGGCTCTTCGATCCCATTCAACCGCTCTATCCTGGTGCTGACACCACAGCGTGCTCTGAAATTCACA
GCACTAACCATCGAACGCCACTACGTTTGGCTAACAGCCCTATCCTTCCTCAGCCATTCCGCAATCGGCCTCCAA
GAATTAGCAGCTCTACCTCCAGTCCCACAAGAAGAATCGCCAACCCCACCTCAAGCCTCCCTCCGCCGAAACCCA
ATTCGCGACTCCATTCGGGTCGCAAAGGGCCGTCCCCGCCCAGTGCCAAAGGACAAACGCTCCTTCAACAGTGCC
GGTGCTCCGGCTCCAGTCCCCGAAATCCCAGGGGGCAGCATCGACCTAGCAGCCGACGCACCCCACGTTCCCCGT
TTCTCAACCCACAGCCGCAAACGCAGCAACACCGCGCCCCGTCCCCCAGCTCTCCACGCTCTCCGCAGCTTCTCC
AGCGCCGGTACTATGCCTTCTTCACACAGCGGCACCACGGCCGGCTCGTCGGAGCTACATTTCCCCGCCATGCAG
CCCCCAGCCCCACCTCCAGGCATTGGAAGTCGTCGTAGCAGTATCAGCCGACGCACTTCCGAGGCGAGTGGCCGT
GCTTCCAGTGGGGCTGGCAGCAACATGTTTGACATAGGCACTGTGCGTATGGAGGCTTTCATCGACCGCCACGCA
GAACAGATTAATCGTCCTCGTGCGCCTCCGCGCCAGCGCCATGTCCGCAAGACATCCAGTCAGTGGAGTGAGAGA
CGGTATGAGTTTGACACGCCTTCGGTCCATGGCAGCGAGTTCTCATACCGTCCTGATGATCCGTGGCGGGGTTTC
TAA
Gene >Pro_DTO377G3_2|g4136.t1
ATGCAACGTGCGACAGGTTACGTGCAACATATGCGACACATACACCCTGGAAACTCTGAAACCAGACTAGGCTCT
GCGAAATTGCGTACGGCGATCGTCGCCCAAACGAGCTACGAATTGGCCGCCAACACAGCCATTTAATTTATCAAA
CACGCTAACCTTTGCTATTTTAGTGTCTTTGGAATCGAAACTATTGGTCATTGCAAAGGCTTTTCTTATTTTTAT
GGTTTGCCTTCCATGATTTCGCCAAACAAAATAGGGGGTGATCTTCCCAGGTCAAAAAAGTGCTTGAGCTTCATG
GCCCAGACACGCAGTGGAGTTCTGTCACGAACTCCTACAACATACCCCAGGCAGTTAATCTATGAATCTTACTCC
GTACGGAGTACACTCATATTCCTTTTCCAGGCTTTCCGACCTTCTGATCAATAGCTCATTCTCTTGAGAATACGG
CCCCGTTTTTATCTCTTTTTTTACCTTTCCTCGTTTCTTTGTCTCCAAATAATCAGCTTCTCCATGACCTTTGAG
ATCTACCACAATACCAAGTATACTCCATACACTCTGGTGATTCTCTCTCGCGCGAACAGACCCTGAAAGCGTTTT
ATACAGGGGATATTGACTGAAGCTCATCTGTCTTAGTGTCTGGCAGCTGCAGTGGAGTATTCAATCCTGTGGGCT
AATCGGGTGGATTCTTTTCTTTCCCCATATGCCCCCTAACGAACGCCCCTGGGACTTTTTTCTTTCTTTTTTAGA
AGTCCAAGACTCTCCTCGCGTCCGTGTTTCCGATATGCGCAGGCATGCCGCAAGGCTGATCTAATCCCCTAAGGT
CTTTTAATGGTCTAAGCCCCGACTCCTCCCAGGTCATTACCTTCGTAAGTACTCCGTACGGCGTAAATCTACAGA
GTACTGGATCTCAGGGGATTCTATAATCGCGATCGGCCCTCGCATCCTTCGGGTTGATCTATTTTCCCTCCCGGA
ATCGGGCCATACCTCCCGATTGACATCTTCCTCCTCTCTTAAGCTAAAACGGTCAGACCTGTTTGTCACTGGAGT
ACTCCGTAAGTAGAGTTAGGGGGCCTCTCTTCCCGTGCATATCCAAATATCGGCATTGCGCTCAAGCGTGCATCT
TACACATCTTCATTGTAACCGTGGCTGACCTCTTCGTTCCACCAAGTGTCAAAAGTCCCAGCGTTGAATTTCCCC
TCCATCCCGCGTTCGACCAGTCGATTGCACCGAGCGAAAACCTGTCTCTGGAGAGAGACAAGCGCCGGCTTCAAA
ACAGTCAATAGTCGGATGGTTGAACTACGGTAGTCTTTTGATGGGATCCAGTGCGTGAAGTGCTCTGGTTAGCCC
AAGGAGCAGAGCCTCGATGGTTTGAGGCGGTTCATCCGGCACATTCACAAAGAGAGATGGCCGATTTACAGTGGC
CGCCTTCCATGGCCCACCCCTCCCCGGCGCCATCCTTTAGATCCAGATCTCGAGCTCCATCCAAAGGAGGATCGA
GATCGAGATCGAGACCGTCCTTGCGCCGGCGAGATTCCTCCCCGACACCTTCCTCCCCACCTGGCCTCCCAACCC
CCGCATTCTCCCCCGACGGACAAACAGACGAAGATGATATCGATATCACCGAGGATACCCTATCCCCCTTCGACC
CGCGGAGGATCACACCCACTCTCCATGCATCTCTCGTATCGGAGATTCTCTCGCTACGGCGGGAGATAGAGAACA
AAACCAAGGCAATCGATGGGTTAGAAGAGAGCTTGGACGAATCAAGGACTGAAAATGAAACACTGACCACGAATC
TGTCCCAGGCGACCTGGGAAGGGCGCTCGTTGAAACATCAAATCCAACTATTGGAAGGTGGAACGTCATCTGCGA
TGGCCGAGCTAGCTCGGGAGCGCGATGAAGCGGTCGAGAACATCGGCGATGTTCGTAAAAGGCTCGAGCAGGCAC
AGAAAAAAGCCCGAAGTCGGGAGGAGGACGTCGAACGAACTCAATTACTCTGGAGTCGCGACCAAGACTCCTGGG
CGGATGAACGCCGAGCCCTGGAACGCAAGATTCACGTAGTAGAGGGCCGCTTGAAGACCGTTTTGAACGAGGTCG
CAGCCGCCCAGGAAGTGGTGACTATCCGCTCGCGTTCACAACCGAGTGAGAATAGTGACCATATTCATGACAAGA
ATAAAGAAAGCGACTCAGCCAGTGTGGCATCTAGTAGCCTAGGCCGCCGACGCACGAGCGTGACCACCTTGAGCT
CAGAAGAAGGTGAAGAGGCGGTCATATTCCATAACGTGCGGTACTCAGTTATGAGTATCGCGCCTGGAAGCAAGA
ATGGTTCAGGTTTGAACCTGGCGGAGGAACTCGACTTCGAGGAAGAGGATGAGGATGAGTTTGTCCCATCTGATG
ATGAGCTGCCTTCCTCTCCGGAGGCGCTGCCCGAAGAACGCCCAATGTCGGTTCACTCACAGGGGTCGCATAGTG
TTTCTTTCAAGGCCAGGAAGATCCTAGGTCTTTCCCTGCAGAGCTCGGACTTATACTCACCCACTGCCCTGGAGT
TCCGTGCACGGGAACTCGGGCTTGCTAGCCCAGTGAAACTTGACCCGGCAGTTGAATACCGCGATATCGGCATCC
AGTACTCACCTCCTCCGTCGCCTACGCTAGAAGGGAAGGTTGTATACGACATTGTTCCTGAGCCCATGGAAACCG
TCTCAGAGCCCGAGAAAGAAGACGACCAGAAAACGAAAATACCTAGAACGAATGACAGCGCCACGCTCCCAGTTG
CACCTCAGATGGTTTCTAATTCTTGTCAGACCGTGGATGAACTCCCAAGTCCTCCATGGACGCCGAATGTGGCTG
ACTCGCCTCAGCCTGTCGAGTCCACCCCGGAGCCGGTGCAAATGAAATCGGCATCCACCCAGACTGATGTCGTTC
CGGAACCATGTGTTGCTCAAAGCGAAAACCTGTCCCCCAATGCCTCATCCAAGATGGACATTCCAATGATCGCTA
TCCACCCACCAGGCTCAGAGCCATCCTCACCTCGAAATAGTGTCGTTCTTCCACCGCAGACCAAGAACATCGCTT
GCCAGGCCAACTTCCGGGCAATTGCTGATTGCCGATCCGTCGCCATCCAAACCGAGGAAATCCGTTTCGATCAAC
GCCCTGTCAGACTTCCTGCCAGTCTTCTTCCTTCTGCTATTCAAGATGCACTACCTCTCCCTGAACCCGAAGAGC
CTAGCCTCGAGTTTTGCACTGTGCCCCCGGTTCCGCCACGGTCCGAGAAACGAAAGCAGAGACGTCTGATAACAG
ATCAGCCGACAGATCATCCCGTGAAGCCTCCTAGAGCACCTGGTCCAGATCATGTGCAGGCGTACCCCGGTAACA
ACGATAATGGTCCGCTCTCAGATGATACCTTGTCCAATATTCGACGGCCTCTACGTTCAAGCAGTCTCTTCGCCG
GCTTTGAGAATAACAGCGATGACGAAGGCCCGCATGGCGAACGCGATGTCTTCACCGACGATGAGCTCCTTAACC
GCCCTTTTGCCGCATACACTGTCAGTCGTGGCAAGCTCATCACTTCGAAATCAAGACCTAGCTTGGACGGCATGC
CTCTCCCCGAGATCGACGAGCAGCTATCTTCCCCGGAGTCAAGACCACCCAATATTGGCCGTTCTCGGGCTTCCC
AGCGGTCTGGTATGACCAGTATTCGCCAGCCCGGCATGCGCAAATTAGCCATGATTTCCAGCGGAACCGCCGCGC
ACCAGAAACCCCGTGCCCGCAGTCCCAGTGAACCAAGCCTCGAGAGCGGCAGTACAGGCTCAAGCATCGCACCGC
CATTCCCTGTACCCATCCGTCTCAGCTCACGCAACCTTCCGCTGAACGGTAGCGACGGGCCTCCAAGTCCTACTC
GCTCAGCCGCCAGACAGTTCTCGGACCGTGGTCGCCAATCTGTCGTCCGGCGCCCAACTCTCCGCCGAGTGCGAT
CCGCAGCAGCAACGTCACAGTCGGATATTACCGAGAGACCAGAAACACTTTCTTCCCCGTCACGATCGACCGCAA
CGTTTTCCCCAGAAAGCCCCGCATACCGACCATATCGGCCACCGCCAATGCCGTGTGATGAGATCACAGCACCTC
GTGAGCGGTACGGGCCATCGAAACGCATCTCGCATCGCACGACTCCATCCCAAACCTGGAACCATGAACAGTGCG
ATAGAAAGGATTCCACCGGTGGTGTGCAGCCAACTAGCGTCGTTGATGCTATTGCTCAGACTATGGTTGGCGAGT
GGATGTTCAAATACGTCCGTCGACGCAAATCATTTGGGATGGGCGAGTCCAAAGAGACTTGGGAGGGCAAGAACC
CTGACGATGTGTCGGCGAATATTACGAACAGTGGTGTGCGACATAAACGATGGGTTTGGCTCGCCCCGTACGAAG
GCTCCATTATGTGGAGTAGTAAACAGCCTACGAGTGGGCCTGCATTACTCGGCAAAAGTGGCCGGAAGTGTAAGT
CTTTAAGGAACTCATTCGATTTGGTTGGAGTGGCAACTAACATAGTATCTCGCCTCGGTATAGTCACGATTCAAT
CCGTCTTGGACGTCAAAGACGACAACCCCATACCCAAAGGCGCCGGCTCTTCGATCCCATTCAACCGCTCTATCC
TGGTGCTGACACCACAGCGTGCTCTGAAATTCACAGCACTAACCATCGAACGCCACTACGTTTGGCTAACAGCCC
TATCCTTCCTCAGCCATTCCGCAATCGGCCTCCAAGAATTAGCAGCTCTACCTCCAGTCCCACAAGAAGAATCGC
CAACCCCACCTCAAGCCTCCCTCCGCCGAAACCCAATTCGCGACTCCATTCGGGTCGCAAAGGGCCGTCCCCGCC
CAGTGCCAAAGGACAAACGCTCCTTCAACAGTGCCGGTGCTCCGGCTCCAGTCCCCGAAATCCCAGGGGGCAGCA
TCGACCTAGCAGCCGACGCACCCCACGTTCCCCGTTTCTCAACCCACAGCCGCAAACGCAGCAACACCGCGCCCC
GTCCCCCAGCTCTCCACGCTCTCCGCAGCTTCTCCAGCGCCGGTACTATGCCTTCTTCACACAGCGGCACCACGG
CCGGCTCGTCGGAGCTACATTTCCCCGCCATGCAGCCCCCAGCCCCACCTCCAGGCATTGGAAGTCGTCGTAGCA
GTATCAGCCGACGCACTTCCGAGGCGAGTGGCCGTGCTTCCAGTGGGGCTGGCAGCAACATGTTTGACATAGGCA
CTGTGCGTATGGAGGCTTTCATCGACCGCCACGCAGAACAGATTAATCGTCCTCGTGCGCCTCCGCGCCAGCGCC
ATGTCCGCAAGACATCCAGTCAGTGGAGTGAGAGACGGTATGAGTTTGACACGCCTTCGGTCCATGGCAGCGAGT
TCTCATACCGTCCTGATGATCCGTGGCGGGGTTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail